KEGG   Mus musculus (mouse): 12391Help
Entry
12391             CDS       T01002                                 

Gene name
Cav3, AI385751, Cav-3, M-cav
Definition
(RefSeq) caveolin 3
  KO
K12959  
caveolin 3
Organism
mmu  Mus musculus (mouse)
Pathway
Endocytosis
Focal adhesion
Bacterial invasion of epithelial cells
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    12391 (Cav3)
  Cellular commiunity
   04510 Focal adhesion
    12391 (Cav3)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    12391 (Cav3)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    12391 (Cav3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6 52.26 cM; 6 E1
AA seq 151 aa AA seqDB search
MMTEEHTDLEARIIKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPEGTYSFDGVWKV
SFTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHI
YSLCIRTFCNPLFAALGQVCSNIKVVLRREG
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccgaagagcacacggatctggaagctcggatcatcaaggacattcactgcaag
gagatagacttggtgaaccgcgaccccaagaacatcaatgaggacattgtgaaggtagat
tttgaagacgtgattgcggagcccgagggcacctacagcttcgacggtgtatggaaggtg
agcttcaccacgttcaccgtctccaagtactggtgctaccgcctgttgtctacactgctg
ggtgttccactggccctgctctggggattcctgttcgcctgtatctccttctgccacatc
tgggccgtggtgccctgcattaagagctacctgatcgagatccagtgcatcagccacatc
tactcactgtgtatccgcaccttctgcaacccgctcttcgctgcgttgggccaggtctgc
agcaacattaaggtggtgctgcgaagggaaggctaa

DBGET integrated database retrieval system