KEGG   Mus musculus (mouse): 12391Help
Entry
12391             CDS       T01002                                 

Gene name
Cav3, AI385751, Cav-3, M-cav
Definition
(RefSeq) caveolin 3
  KO
K12959  
caveolin 3
Organism
mmu  Mus musculus (mouse)
Pathway
Endocytosis
Focal adhesion
Bacterial invasion of epithelial cells
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    12391 (Cav3)
  Cellular community - eukaryotes
   04510 Focal adhesion
    12391 (Cav3)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    12391 (Cav3)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    12391 (Cav3)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    12391 (Cav3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6 E3; 6 52.26 cM
AA seq 151 aa AA seqDB search
MMTEEHTDLEARIIKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPEGTYSFDGVWKV
SFTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHI
YSLCIRTFCNPLFAALGQVCSNIKVVLRREG
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccgaagagcacacggatctggaagctcggatcatcaaggacattcactgcaag
gagatagacttggtgaaccgcgaccccaagaacatcaatgaggacattgtgaaggtagat
tttgaagacgtgattgcggagcccgagggcacctacagcttcgacggtgtatggaaggtg
agcttcaccacgttcaccgtctccaagtactggtgctaccgcctgttgtctacactgctg
ggtgttccactggccctgctctggggattcctgttcgcctgtatctccttctgccacatc
tgggccgtggtgccctgcattaagagctacctgatcgagatccagtgcatcagccacatc
tactcactgtgtatccgcaccttctgcaacccgctcttcgctgcgttgggccaggtctgc
agcaacattaaggtggtgctgcgaagggaaggctaa

DBGET integrated database retrieval system