KEGG   Mus musculus (mouse): 12402Help
Entry
12402             CDS       T01002                                 

Gene name
Cbl, 4732447J05Rik, Cbl-2, c-Cbl
Definition
(RefSeq) Casitas B-lineage lymphoma
  KO
K04707  
E3 ubiquitin-protein ligase CBL [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Pathway
ErbB signaling pathway
Ubiquitin mediated proteolysis
Endocytosis
T cell receptor signaling pathway
Insulin signaling pathway
Bacterial invasion of epithelial cells
Pathways in cancer
Proteoglycans in cancer
Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    12402 (Cbl)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    12402 (Cbl)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    12402 (Cbl)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    12402 (Cbl)
  Endocrine system
   04910 Insulin signaling pathway
    12402 (Cbl)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    12402 (Cbl)
   05205 Proteoglycans in cancer
    12402 (Cbl)
   05220 Chronic myeloid leukemia
    12402 (Cbl)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    12402 (Cbl)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     12402 (Cbl)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    12402 (Cbl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
9 A5.2; 9 24.72 cM
AA seq 913 aa AA seqDB search
MAGNVKKSSGAGGGGSGGSGAGGLIGLMKDAFQPHHHHHHLSPHPPCTVDKKMVEKCWKL
MDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTVLSRYEGKMETLGENEYFRVFMENL
MKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRIT
KADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFD
IFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQ
WAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDHIK
VTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCE
IKGTEPIVVDPFDPRGSGSLLRQGAEGAPSPNYDDDDDERADDSLFMMKELAGAKVERPS
SPFSMAPQASLPPVPPRLDLLQQRAPVPASTSVLGTASKAASGSLHKDKPLPIPPTLRDL
PPPPPPDRPYSVGAETRPQRRPLPCTPGDCPSRDKLPPVPSSRPGDSWLSRPIPKVPVAT
PNPGDPWNGRELTNRHSLPFSLPSQMEPRADVPRLGSTFSLDTSMTMNSSPVAGPESEHP
KIKPSSSANAIYSLAARPLPMPKLPPGEQGESEEDTEYMTPTSRPVGVQKPEPKRPLEAT
QSSRACDCDQQIDSCTYEAMYNIQSQALSVAENSASGEGNLATAHTSTGPEESENEDDGY
DVPKPPVPAVLARRTLSDISNASSSFGWLSLDGDPTNFNEGSQVPERPPKPFPRRINSER
KASSYQQGGGATANPVATAPSPQLSSEIERLMSQGYSYQDIQKALVIAHNNIEMAKNILR
EFVSISSPAHVAT
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atggccggcaacgtgaagaagagctcgggcgccggcggcggcggctctgggggctcggga
gcgggcggcctgatcgggctcatgaaggacgccttccagccgcaccaccaccaccaccac
ctcagcccgcaccctccctgcacggtggacaagaagatggtggagaagtgctggaagctc
atggacaaggtggtgcggttgtgtcaaaacccaaagctggcgctcaagaacagcccgcct
tatatcttagacctgctgcctgacacctaccagcacctccgcactgtcttgtcaagatat
gaggggaagatggagacgcttggagaaaatgagtatttcagggtgttcatggaaaatttg
atgaagaaaactaagcagactatcagcctcttcaaggagggaaaagaaaggatgtatgag
gagaattcccagcctaggcgaaacctgaccaaattatccctgatcttcagccacatgctg
gcagaactgaaaggcatctttccgagcggactcttccaaggagacactttccggattact
aaagctgatgctgccgaattttggagaaaagcttttggtgaaaagacgatagtcccgtgg
aagagctttcgacaggccctgcatgaagtgcatcccatcagttctgggctggaggccatg
gctctgaagtccactattgatctgacctgcaatgattatatttctgtctttgaatttgat
atttttacacggctgtttcagccctggtcctctttgctcagaaattggaacagccttgct
gtaactcaccctggttacatggctttcctgacatacgatgaagtgaaagcgcgcctgcag
aagttcatccacaaacctggcagttacatctttcggctgagctgtactcgtttgggtcag
tgggctattgggtatgttactgccgatgggaacattctgcagacaatcccacacaataaa
ccgctcttccaagcactgattgatggcttcagggaaggcttctatttgtttcctgatgga
cgaaatcaaaatcctgacctgacaggtttatgtgaaccaactcctcaagatcatatcaaa
gtaacccaggaacaatatgaattatactgtgaaatgggctccacatttcaactgtgtaag
atatgtgctgagaatgataaggatgtgaagattgagccctgtggacacctcatgtgcaca
tcctgcctcacgtcgtggcaggaatcagaaggtcagggctgtcctttttgccgatgtgaa
atcaaaggtactgagcccatcgtggtggatccgtttgaccccagaggcagtggcagccta
ttaaggcaaggagcagaaggtgctccttccccaaattacgacgatgatgatgatgaacga
gctgatgattctctcttcatgatgaaggagttggcaggtgccaaggtggaaaggccttcc
tctccattctccatggccccacaagcttcccttcctccagtgccaccaagacttgacctt
ctacagcagcgagcacctgttcctgccagcacttcagttctggggactgcttccaaggct
gcttctggctcccttcataaagacaaaccattgccaatacctcccacacttcgagatctt
ccaccaccaccccctccagaccggccttactctgttggagcagaaacaaggcctcagaga
cgccctctgccttgtacaccaggcgattgtccatctagagacaaactgccccctgtccct
tctagccgcccaggggactcgtggttgtctcggccaatccctaaagtaccagtagctact
ccaaaccctggtgatccttggaatgggagagaattgaccaatcggcactcgcttccattc
tcattgccctcacaaatggaacccagagcagatgtccctaggcttggaagcacatttagt
ctggatacctctatgactatgaatagcagcccagtagcaggtccagagagtgagcaccca
aagatcaagccttcctcgtctgccaacgccatttactctctggctgccaggcctcttcct
atgccaaaactgccacctggggagcaaggggaaagtgaagaggacacagaatatatgact
cccacatctaggcctgtaggggttcagaagccagagcccaaacggccgttagaggcaacc
cagagttcacgagcatgtgactgtgaccagcagatcgacagctgtacctatgaagcgatg
tataacatccagtcccaagcactgtctgtagcagaaaacagcgcctctggggaagggaat
ctggccacagctcacacgagtactggccctgaggaatccgaaaacgaggatgatggctat
gatgtgcctaagccacccgtgccagctgtactggcccgccggaccctgtctgacatctcc
aatgccagctcctcctttggctggttgtctttggatggtgaccctacaaacttcaatgag
ggttcccaagttcctgagcggccccccaaaccattccctcggagaatcaactcagaacga
aaagccagtagctatcaacaaggcggaggtgccactgctaaccctgtggccacagcaccc
tcaccgcagctctcaagtgagattgaacgcctcatgagtcagggctattcctaccaggac
attcagaaagctttggtcattgcccacaacaacattgagatggctaaaaacatcctccgg
gaatttgtttctatttcttctcctgctcacgtagccacctag

DBGET integrated database retrieval system