KEGG   Mus musculus (mouse): 12419Help
Entry
12419             CDS       T01002                                 

Gene name
Cbx5, 2610029O15Rik, C75991, HP1, Hp1a, Hp1alpha
Definition
(RefSeq) chromobox 5
  KO
K11587  
chromobox protein 5
Organism
mmu  Mus musculus (mouse)
Brite
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Heterochromatin formation proteins
   HP1 (heterochromatin protein 1)
    12419 (Cbx5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15; 15 F3
AA seq 191 aa AA seqDB search
MGKKTKRTADSSSSEDEEEYVVEKVLDRRMVKGQVEYLLKWKGFSEEHNTWEPEKNLDCP
ELISEFMKKYKKMKEGENNKPREKSEGNKRKSSFSNSADDIKSKKKREQSNDIARGFERG
LEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPED
AENKEKESAKS
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagaagaccaagaggacagccgacagctcttcttcagaggatgaggaggaatat
gtggtggaaaaggtgttggacaggcgcatggttaaggggcaagtggaatatctgttgaag
tggaaaggcttttctgaggagcacaatacttgggaacctgagaagaacttggattgtcct
gaactaatttctgagtttatgaaaaagtataagaagatgaaggagggtgaaaacaataag
cccagggagaaatcagaaggaaacaagaggaaatccagtttctccaacagcgctgatgat
attaaatctaaaaaaaagagagagcaaagcaatgatatcgctcggggctttgagagagga
ctggaaccagaaaagatcatcggagcaacagattcctgcggtgacttaatgttcttaatg
aaatggaaagacacagatgaagctgacctggttcttgcaaaagaagctaacgtgaagtgt
ccacagattgtgatagcattttatgaagagagactgacgtggcacgcatatccagaggat
gcggaaaacaaagaaaaagaaagcgcgaagagctaa

DBGET integrated database retrieval system