KEGG   Mus musculus (mouse): 12425Help
Entry
12425             CDS       T01002                                 

Gene name
Cckar, AW106902
Definition
(RefSeq) cholecystokinin A receptor
  KO
K04194  
cholecystokinin A receptor
Organism
mmu  Mus musculus (mouse)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Insulin secretion
Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    12425 (Cckar)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    12425 (Cckar)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    12425 (Cckar)
  Digestive system
   04972 Pancreatic secretion
    12425 (Cckar)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Gut peptide
   Cholecystokinin
    12425 (Cckar)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 C1; 5 29.52 cM
AA seq 436 aa AA seqDB search
MDVVDSLLMNGSNITPPCELGLENETLFCLDQPQPSKEWQSAVQILLYSFIFLLSVLGNT
LVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYF
MGTSVSVSTFNLVAISLERYGAICRPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYS
NLVPFTKNNNQTANMCRFLLPSDAMQQSWQTFLLLILFLIPGVVMVVAYGLISLELYQGI
KFDASQKKSAKEKRLSSGGGGGGGSSSSRYEDSDGCYLQKSRPPRKLELQQLSTSSSGGR
INRIRSSGSAANLIAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTVSAEKHLSGTPI
SFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPTGVRGEVGEEEDGRTIRAS
LSRYSYSHMSTSAPPH
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggatgtggtcgacagccttcttatgaatgggagcaacatcactcccccctgtgaactc
gggctggaaaatgagacgcttttctgcctggatcaacctcagccttcaaaagaatggcag
tctgcagtgcagattctcctgtactccttcatattccttctcagtgtgctggggaacacg
ctggttatcacggtgctgattcgaaacaagaggatgcggactgtcaccaacatcttcctg
ctgtccctggctgtcagtgacctcatgctttgcctcttctgcatgccgttcaacctcatc
cccaacctgctcaaggatttcatcttcggaagtgccgtgtgcaagactaccacctacttc
atgggcacttccgtgagtgtttccaccttcaacctggtagccatctctctggagagatac
ggtgccatctgcagacccctacaatcccgcgtctggcaaacaaagtcccatgctttgaag
gtcatcgctgccacctggtgcctctcctttaccatcatgactccgtaccccatttacagc
aacttggtgccttttactaaaaacaataaccagacggcgaacatgtgccgcttcctgttg
ccaagtgacgctatgcagcagtcctggcaaacattcctgctactcatcctcttccttatc
cctggggttgtgatggtggtggcttacggactcatctctctggaactctaccaaggaatc
aaatttgatgccagccagaagaaatctgctaaagagaagaggctaagcagcggcggcggc
ggcggcggcggtagcagcagcagccgatatgaggatagcgatggctgttacttgcagaaa
tccaggcctccaaggaagctagagctgcagcagctgtcaaccagcagcagtggtggcaga
atcaaccggatcaggagcagtggttctgctgccaacctgatcgccaagaagcgcgtgatc
cgcatgctcattgtcattgtggtcctcttcttcctgtgctggatgcccatcttcagtgcc
aatgcctggcgggcatatgacacggtttctgccgagaaacacctctcagggacccccatc
tccttcatcctcctcctctcctacacctcctcctgtgtcaaccccattatctactgcttc
atgaacaaacgctttcgcctgggcttcatggccaccttcccctgttgcccgaatcctggt
cccaccggggtgagaggagaagtgggagaggaggaagatggaaggaccataagggcatcc
ctgtcccggtattcctacagccacatgagcacctctgccccaccccactga

DBGET integrated database retrieval system