KEGG   Mus musculus (mouse): 12426Help
Entry
12426             CDS       T01002                                 

Gene name
Cckbr, CCK2R, CCKR-2
Definition
cholecystokinin B receptor
Orthology
K04195  
cholecystokinin B receptor
Organism
mmu  Mus musculus (mouse)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Gastric acid secretion
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:mmu04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:mmu04080]
Organismal Systems; Digestive system; Gastric acid secretion [PATH:mmu04971]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 E3; 7 55.86 cM
AA seq 453 aa AA seqDB search
MDLLKLNRSLQGPGPGSGSSLCRPGVSLLNSSSAGNLSCETPRIRGTGTRELELTIRITL
YAVIFLMSVGGNVLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTF
IFGTVICKAVSYLMGVSVSVSTLNLAAIALERYSAICRPLQARVWQTRSHAARVILATWL
LSGLLMVPYPVYTVVQPVGPRILQCMHLWPSERVQQMWSVLLLILLFFIPGVVMAVAYGL
ISRELYLGLRFDGDNDSETQSRVRNQGGLPGGAAAPGPVHQNGGCRHVTSLTGEDSDGCY
VQLPRSRLEMTTLTTPTTGPGPGPRPNQAKLLAKKRVVRMLLVIVLLFFVCWLPVYSANT
WRAFDGPGARRALAGAPISFIHLLSYTSACANPLVYCFMHRRFRQACLDTCARCCPRPPR
ARPRPLPDEDPPTPSIASLSRLSYTTISTLGPG
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggatctgctcaagctgaaccgcagcttgcagggaccaggacccgggtcagggtcttct
ttgtgccgcccgggtgtctccctcctcaacagcagtagcgccggcaacctcagctgcgag
acccctcgtatccgcggaaccgggaccagagaattggagttgaccattcgaatcaccctt
tatgcggtgatctttctgatgagtgttggcggaaacgtgctcatcattgtggtcctggga
ctgagccgacgcctaagaacggtcaccaacgccttcctactctccctggcagtcagcgac
ctcctgctggctgtcgcttgcatgcccttcacactcctgcccaacctcatgggcacattc
atcttcggcacagtcatctgcaaggccgtttcctacctcatgggggtatcagtgagtgtg
tccactctaaatctcgcggccatcgccctggagcgatacagcgccatctgccgaccactg
caagcacgagtgtggcagacacgctcccacgcagctcgggtgatcttagccacgtggctg
ctgtctggattgcttatggtcccctaccccgtgtacaccgtggtgcagccagtggggcct
cgaatactgcagtgcatgcatctctggcccagtgaacgtgtccaacaaatgtggtccgtg
cttctgctaatactgctgttcttcatcccgggcgtggttatggcggtggcctatggactc
atctcccgcgaactctacctagggctccgctttgatggtgataatgacagcgagacccaa
agccgggtccgaaaccaagggggtctgccgggtggggcagcagcaccagggcctgtccac
cagaacgggggttgccggcatgtgaccagcctgactggggaagacagtgatggctgctac
gtgcaacttccgcgttcccgactggagatgacaacgctgaccacgcccactactgggcca
ggccctggccctcggcccaaccaggccaagctgctggctaagaagcgggtggtgcgaatg
ctgctggtgattgttttgctttttttcgtgtgttggctgccagtgtacagcgccaacacg
tggcgtgccttcgatggcccaggcgcgcgccgagcactcgcaggggcccctatctctttc
atccacttgctgagctacacctctgcttgtgccaaccccctggtctactgtttcatgcac
cgccgattccgccaggcctgcctggacacatgtgcccgctgttgcccacgccctccacga
gctcgcccacggcctcttccggatgaggatcctcctaccccctccatcgcttctctgtcc
aggctaagctataccaccatcagcacgctgggacctggctga

DBGET integrated database retrieval system