KEGG   Mus musculus (mouse): 12426Help
Entry
12426             CDS       T01002                                 

Gene name
Cckbr, CCK-BR, CCK2-R, CCK2R, CCKR-2
Definition
(RefSeq) cholecystokinin B receptor
  KO
K04195  cholecystokinin B receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    12426 (Cckbr)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    12426 (Cckbr)
 Organismal Systems
  Digestive system
   04971 Gastric acid secretion
    12426 (Cckbr)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Gut peptide
   Cholecystokinin
    12426 (Cckbr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Motif
Other DBs
NCBI-GeneID: 12426
NCBI-ProteinID: NP_031653
MGI: 99479
Ensembl: ENSMUSG00000030898
Vega: OTTMUSG00000042484
UniProt: P56481 Q3ZB46
Position
7 E3; 7 55.86 cM
AA seq 453 aa AA seqDB search
MDLLKLNRSLQGPGPGSGSSLCRPGVSLLNSSSAGNLSCETPRIRGTGTRELELTIRITL
YAVIFLMSVGGNVLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTF
IFGTVICKAVSYLMGVSVSVSTLNLAAIALERYSAICRPLQARVWQTRSHAARVILATWL
LSGLLMVPYPVYTVVQPVGPRILQCMHLWPSERVQQMWSVLLLILLFFIPGVVMAVAYGL
ISRELYLGLRFDGDNDSETQSRVRNQGGLPGGAAAPGPVHQNGGCRHVTSLTGEDSDGCY
VQLPRSRLEMTTLTTPTTGPGPGPRPNQAKLLAKKRVVRMLLVIVLLFFVCWLPVYSANT
WRAFDGPGARRALAGAPISFIHLLSYTSACANPLVYCFMHRRFRQACLDTCARCCPRPPR
ARPRPLPDEDPPTPSIASLSRLSYTTISTLGPG
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggatctgctcaagctgaaccgcagcttgcagggaccaggacccgggtcagggtcttct
ttgtgccgcccgggtgtctccctcctcaacagcagtagcgccggcaacctcagctgcgag
acccctcgtatccgcggaaccgggaccagagaattggagttgaccattcgaatcaccctt
tatgcggtgatctttctgatgagtgttggcggaaacgtgctcatcattgtggtcctggga
ctgagccgacgcctaagaacggtcaccaacgccttcctactctccctggcagtcagcgac
ctcctgctggctgtcgcttgcatgcccttcacactcctgcccaacctcatgggcacattc
atcttcggcacagtcatctgcaaggccgtttcctacctcatgggggtatcagtgagtgtg
tccactctaaatctcgcggccatcgccctggagcgatacagcgccatctgccgaccactg
caagcacgagtgtggcagacacgctcccacgcagctcgggtgatcttagccacgtggctg
ctgtctggattgcttatggtcccctaccccgtgtacaccgtggtgcagccagtggggcct
cgaatactgcagtgcatgcatctctggcccagtgaacgtgtccaacaaatgtggtccgtg
cttctgctaatactgctgttcttcatcccgggcgtggttatggcggtggcctatggactc
atctcccgcgaactctacctagggctccgctttgatggtgataatgacagcgagacccaa
agccgggtccgaaaccaagggggtctgccgggtggggcagcagcaccagggcctgtccac
cagaacgggggttgccggcatgtgaccagcctgactggggaagacagtgatggctgctac
gtgcaacttccgcgttcccgactggagatgacaacgctgaccacgcccactactgggcca
ggccctggccctcggcccaaccaggccaagctgctggctaagaagcgggtggtgcgaatg
ctgctggtgattgttttgctttttttcgtgtgttggctgccagtgtacagcgccaacacg
tggcgtgccttcgatggcccaggcgcgcgccgagcactcgcaggggcccctatctctttc
atccacttgctgagctacacctctgcttgtgccaaccccctggtctactgtttcatgcac
cgccgattccgccaggcctgcctggacacatgtgcccgctgttgcccacgccctccacga
gctcgcccacggcctcttccggatgaggatcctcctaccccctccatcgcttctctgtcc
aggctaagctataccaccatcagcacgctgggacctggctga

DBGET integrated database retrieval system