KEGG   Mus musculus (mouse): 12428Help
Entry
12428             CDS       T01002                                 

Gene name
Ccna2, AA408589, Ccn-1, Ccn1, Ccna, CycA2, Cyca
Definition
(RefSeq) cyclin A2
  KO
K06627  
cyclin A
Organism
mmu  Mus musculus (mouse)
Pathway
Cell cycle
AMPK signaling pathway
Progesterone-mediated oocyte maturation
Hepatitis B
Epstein-Barr virus infection
Viral carcinogenesis
Module
Cell cycle - G2/M transition
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    12428 (Ccna2)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    12428 (Ccna2)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    12428 (Ccna2)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    12428 (Ccna2)
  Infectious diseases
   05161 Hepatitis B
    12428 (Ccna2)
   05169 Epstein-Barr virus infection
    12428 (Ccna2)
DNA replication proteins [BR:mmu03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    12428 (Ccna2)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    12428 (Ccna2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3 B; 3 17.67 cM
AA seq 422 aa AA seqDB search
MPGTSRHSGRDAGSALLSLHQEDQENVNPEKLAPAQQPRAQAVLKAGNVRGPAPQQKLKT
RRVAPLKDLPINDEHVTAGPSWKAVSKQPAFTIHVDEAEETQKRPAELKETECEDALAFN
AAVSLPGARKPLTPLDYPMDGSFESPHAMDMSIVLEDKPVNVNEVPDYQEDIHTYLREME
VKCKPKVGYMKRQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLR
GKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYSKKQVLRMEHLVLKVLAFDLAAPT
VNQFLTQYFLHLQPANCKVESLAMFLGELSLIDADPYLKYLPSLIAGAAFHLALYTVTGQ
SWPESLAQQTGYTLESLKPCLVDLHQTYLKAPQHAQQSIREKYKHSKYHSVSLLNPPETL
SV
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgccgggcacctcgaggcattcgggtcgcgatgcgggctcagccctgctctcgctgcat
caggaagaccaagagaatgtcaaccccgaaaaactggcgccagcccagcagccgcgggcg
caggcggtgctgaaggccgggaacgtgcgtggacccgcgccgcagcagaagctcaagact
cgacgggttgctcctcttaaggaccttcctataaacgatgagcatgtcactgctggtcct
tcatggaaagcagtcagtaaacagcctgccttcaccattcatgtggatgaagcagaagag
actcagaagaggccagctgagcttaaagaaacagagtgtgaagatgccctggcttttaat
gcagctgtctctttacccggagcaagaaaaccactgacacctcttgactatccaatggat
ggcagttttgaatcaccacatgctatggatatgtctattgtcttagaagacaagccagtg
aacgttaatgaagtacctgactatcaagaagacattcacacgtaccttagggaaatggag
gttaaatgtaaacctaaagtgggttacatgaagaggcagccagacatcactaacagcatg
agggccatccttgtggactggctggttgaggtgggagaagaatataaactacagaatgag
accctgcatttggctgtgaactacattgatagattcctctcctccatgtctgtgttaaga
gggaagcttcagcttgtaggcacggctgctatgctgctagcttcgaagtttgaagaaata
taccccccagaagtagcagagtttgtgtatattacagacgatacctattccaagaagcag
gttctgagaatggagcacctagtattgaaagtccttgcttttgacttggctgcaccaaca
gtaaatcagttccttacccagtacttcctgcacctgcagcctgcaaactgtaaggttgaa
agcttagcaatgtttttgggagaactgagtttgatagatgctgacccgtaccttaagtac
ctgccttcactcattgctggagctgccttccacttggctctctacacagtcacaggacag
agctggcctgagtcattggcacaacagactggatataccctggagagtcttaagccttgt
cttgtggaccttcaccagacctacctcaaagcgccacaacatgcccaacagtcaatacgg
gaaaagtacaagcattcaaaatatcacagtgtttctcttctcaacccaccagagacacta
agtgtgtga

DBGET integrated database retrieval system