KEGG   Mus musculus (mouse): 12428Help
Entry
12428             CDS       T01002                                 

Gene name
Ccna2, AA408589, Ccn-1, Ccn1, Ccna, CycA2, Cyca
Definition
(RefSeq) cyclin A2
  KO
K06627  
cyclin-A
Organism
mmu  Mus musculus (mouse)
Pathway
Cell cycle
AMPK signaling pathway
Cellular senescence
Progesterone-mediated oocyte maturation
Hepatitis B
Human papillomavirus infection
Epstein-Barr virus infection
Viral carcinogenesis
Module
Cell cycle - G2/M transition
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    12428 (Ccna2)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    12428 (Ccna2)
   04218 Cellular senescence
    12428 (Ccna2)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    12428 (Ccna2)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    12428 (Ccna2)
  Infectious diseases
   05161 Hepatitis B
    12428 (Ccna2)
   05169 Epstein-Barr virus infection
    12428 (Ccna2)
   05165 Human papillomavirus infection
    12428 (Ccna2)
DNA replication proteins [BR:mmu03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    12428 (Ccna2)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    12428 (Ccna2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3 B; 3 17.67 cM
AA seq 422 aa AA seqDB search
MPGTSRHSGRDAGSALLSLHQEDQENVNPEKLAPAQQPRAQAVLKAGNVRGPAPQQKLKT
RRVAPLKDLPINDEHVTAGPSWKAVSKQPAFTIHVDEAEETQKRPAELKETECEDALAFN
AAVSLPGARKPLTPLDYPMDGSFESPHAMDMSIVLEDKPVNVNEVPDYQEDIHTYLREME
VKCKPKVGYMKRQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLR
GKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYSKKQVLRMEHLVLKVLAFDLAAPT
VNQFLTQYFLHLQPANCKVESLAMFLGELSLIDADPYLKYLPSLIAGAAFHLALYTVTGQ
SWPESLAQQTGYTLESLKPCLVDLHQTYLKAPQHAQQSIREKYKHSKYHSVSLLNPPETL
SV
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgccgggcacctcgaggcattcgggtcgcgatgcgggctcagccctgctctcgctgcat
caggaagaccaagagaatgtcaaccccgaaaaactggcgccagcccagcagccgcgggcg
caggcggtgctgaaggccgggaacgtgcgtggacccgcgccgcagcagaagctcaagact
cgacgggttgctcctcttaaggaccttcctataaacgatgagcatgtcactgctggtcct
tcatggaaagcagtcagtaaacagcctgccttcaccattcatgtggatgaagcagaagag
actcagaagaggccagctgagcttaaagaaacagagtgtgaagatgccctggcttttaat
gcagctgtctctttacccggagcaagaaaaccactgacacctcttgactatccaatggat
ggcagttttgaatcaccacatgctatggatatgtctattgtcttagaagacaagccagtg
aacgttaatgaagtacctgactatcaagaagacattcacacgtaccttagggaaatggag
gttaaatgtaaacctaaagtgggttacatgaagaggcagccagacatcactaacagcatg
agggccatccttgtggactggctggttgaggtgggagaagaatataaactacagaatgag
accctgcatttggctgtgaactacattgatagattcctctcctccatgtctgtgttaaga
gggaagcttcagcttgtaggcacggctgctatgctgctagcttcgaagtttgaagaaata
taccccccagaagtagcagagtttgtgtatattacagacgatacctattccaagaagcag
gttctgagaatggagcacctagtattgaaagtccttgcttttgacttggctgcaccaaca
gtaaatcagttccttacccagtacttcctgcacctgcagcctgcaaactgtaaggttgaa
agcttagcaatgtttttgggagaactgagtttgatagatgctgacccgtaccttaagtac
ctgccttcactcattgctggagctgccttccacttggctctctacacagtcacaggacag
agctggcctgagtcattggcacaacagactggatataccctggagagtcttaagccttgt
cttgtggaccttcaccagacctacctcaaagcgccacaacatgcccaacagtcaatacgg
gaaaagtacaagcattcaaaatatcacagtgtttctcttctcaacccaccagagacacta
agtgtgtga

DBGET integrated database retrieval system