KEGG   Mus musculus (mouse): 12443Help
Entry
12443             CDS       T01002                                 

Gene name
Ccnd1, AI327039, CycD1, Cyl-1, PRAD1, bcl-1, cD1
Definition
(RefSeq) cyclin D1
  KO
K04503  
cyclin D1
Organism
mmu  Mus musculus (mouse)
Pathway
FoxO signaling pathway
Cell cycle
p53 signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Wnt signaling pathway
Hedgehog signaling pathway
Hippo signaling pathway
Focal adhesion
Jak-STAT signaling pathway
Prolactin signaling pathway
Thyroid hormone signaling pathway
Oxytocin signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Hepatitis B
Measles
HTLV-I infection
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
MicroRNAs in cancer
Colorectal cancer
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Thyroid cancer
Melanoma
Bladder cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Viral myocarditis
Module
Cell cycle - G1/S transition
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    12443 (Ccnd1)
   04340 Hedgehog signaling pathway
    12443 (Ccnd1)
   04390 Hippo signaling pathway
    12443 (Ccnd1)
   04630 Jak-STAT signaling pathway
    12443 (Ccnd1)
   04068 FoxO signaling pathway
    12443 (Ccnd1)
   04151 PI3K-Akt signaling pathway
    12443 (Ccnd1)
   04152 AMPK signaling pathway
    12443 (Ccnd1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    12443 (Ccnd1)
   04115 p53 signaling pathway
    12443 (Ccnd1)
  Cellular commiunity
   04510 Focal adhesion
    12443 (Ccnd1)
 Organismal Systems
  Endocrine system
   04917 Prolactin signaling pathway
    12443 (Ccnd1)
   04921 Oxytocin signaling pathway
    12443 (Ccnd1)
   04919 Thyroid hormone signaling pathway
    12443 (Ccnd1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    12443 (Ccnd1)
   05206 MicroRNAs in cancer
    12443 (Ccnd1)
   05205 Proteoglycans in cancer
    12443 (Ccnd1)
   05203 Viral carcinogenesis
    12443 (Ccnd1)
   05210 Colorectal cancer
    12443 (Ccnd1)
   05212 Pancreatic cancer
    12443 (Ccnd1)
   05214 Glioma
    12443 (Ccnd1)
   05216 Thyroid cancer
    12443 (Ccnd1)
   05221 Acute myeloid leukemia
    12443 (Ccnd1)
   05220 Chronic myeloid leukemia
    12443 (Ccnd1)
   05218 Melanoma
    12443 (Ccnd1)
   05219 Bladder cancer
    12443 (Ccnd1)
   05215 Prostate cancer
    12443 (Ccnd1)
   05213 Endometrial cancer
    12443 (Ccnd1)
   05222 Small cell lung cancer
    12443 (Ccnd1)
   05223 Non-small cell lung cancer
    12443 (Ccnd1)
  Cardiovascular diseases
   05416 Viral myocarditis
    12443 (Ccnd1)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    12443 (Ccnd1)
  Infectious diseases
   05166 HTLV-I infection
    12443 (Ccnd1)
   05162 Measles
    12443 (Ccnd1)
   05161 Hepatitis B
    12443 (Ccnd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 F5; 7 88.92 cM
AA seq 295 aa AA seqDB search
MEHQLLCCEVETIRRAYPDTNLLNDRVLRAMLKTEETCAPSVSYFKCVQKEIVPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPLKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEADENKQTIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAMQGLNLGSPNNFLSCYRTTHFLSRVIKCD
PDCLRACQEQIEALLESSLRQAQQNVDPKATEEEGEVEEEAGLACTPTDVRDVDI
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggaacaccagctcctgtgctgcgaagtggagaccatccgccgcgcgtaccctgacacc
aatctcctcaacgaccgggtgctgcgagccatgctcaagacggaggagacctgtgcgccc
tccgtatcttacttcaagtgcgtgcagaaggagattgtgccatccatgcggaaaatcgtg
gccacctggatgctggaggtctgtgaggagcagaagtgcgaagaggaggtcttcccgctg
gccatgaactacctggaccgcttcctgtccctggagcccttgaagaagagccgcctgcag
ctgctgggggccacctgcatgttcgtggcctctaagatgaaggagaccattcccttgact
gccgagaagttgtgcatctacactgacaactctatccggcccgaggagctgctgcaaatg
gaactgcttctggtgaacaagctcaagtggaacctggccgccatgactccccacgatttc
atcgaacacttcctctccaaaatgccagaggcggatgagaacaagcagaccatccgcaag
catgcacagacctttgtggccctctgtgccacagatgtgaagttcatttccaacccaccc
tccatggtagctgctgggagcgtggtggctgcgatgcaaggcctgaacctgggcagcccc
aacaacttcctctcctgctaccgcacaacgcactttctttccagagtcatcaagtgtgac
ccggactgcctccgtgcctgccaggaacagattgaagcccttctggagtcaagcctgcgc
caggcccagcagaacgtcgaccccaaggccactgaggaggagggggaagtggaggaagag
gctggtctggcctgcacgcccaccgacgtgcgagatgtggacatctga

DBGET integrated database retrieval system