KEGG   Mus musculus (mouse): 12458Help
Entry
12458             CDS       T01002                                 

Gene name
Ccr6, CC-CKR-6, CCR-6, Cmkbr6, KY411
Definition
(RefSeq) chemokine (C-C motif) receptor 6
  KO
K04181  
C-C chemokine receptor type 6
Organism
mmu  Mus musculus (mouse)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12458 (Ccr6)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    12458 (Ccr6)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Chemokine
   CC Chemokine
    12458 (Ccr6)
Cytokine receptors [BR:mmu04050]
 Chemokine receptors
  CC Chemokine
   12458 (Ccr6)
Cellular antigens [BR:mmu04090]
 Proteins
  12458 (Ccr6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
17; 17 A1
AA seq 367 aa AA seqDB search
MNSTESYFGTDDYDNTEYYSIPPDHGPCSLEEVRNFTKVFVPIAYSLICVFGLLGNIMVV
MTFAFYKKARSMTDVYLLNMAITDILFVLTLPFWAVTHATNTWVFSDALCKLMKGTYAVN
FNCGMLLLACISMDRYIAIVQATKSFRVRSRTLTHSKVICVAVWFISIIISSPTFIFNKK
YELQDRDVCEPRYRSVSEPITWKLLGMGLELFFGFFTPLLFMVFCYLFIIKTLVQAQNSK
RHRAIRVVIAVVLVFLACQIPHNMVLLVTAVNTGKVGRSCSTEKVLAYTRNVAEVLAFLH
CCLNPVLYAFIGQKFRNYFMKIMKDVWCMRRKNKMPGFLCARVYSESYISRQTSETVEND
NASSFTM
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaattccacagagtcctactttggaacggatgattatgacaacacagagtattattct
attcctccagaccatgggccatgctccctagaagaggtcagaaacttcaccaaggtattt
gtgccaattgcctactccttaatatgtgtctttggcctcctgggcaacattatggtggtg
atgacctttgccttctacaagaaagccagatccatgactgacgtctacctgttgaacatg
gccatcacagacatactctttgtcctcaccctaccgttctgggcagttactcatgccacc
aacacttgggttttcagcgatgcactgtgtaaactgatgaaaggcacatatgcggtcaac
tttaactgtgggatgctgctcctggcctgtatcagcatggaccggtacattgccatcgtc
caggcaaccaaatctttccgggtacgctccagaacactgacgcacagtaaggtcatctgt
gtggcagtgtggttcatctccatcatcatctcaagccctacatttatcttcaacaagaaa
tacgagctgcaggatcgtgatgtctgtgagccacggtacaggtctgtctcagagcccatc
acgtggaagctgctgggtatgggactggagctgttctttgggttcttcacccctttgctg
tttatggtgttctgctatctgttcattatcaagaccttggtgcaggcccagaactccaag
aggcacagagcaatccgagtcgtgatcgctgtggttctcgtgttcctggcttgtcagatc
cctcacaacatggtcctcctcgtgactgcggtcaacacgggcaaagtgggccggagctgc
agcaccgagaaagtcctcgcctacaccaggaacgtggccgaggtcctggctttcctgcat
tgctgcctcaaccccgtgttgtatgcgtttattggacagaaattcagaaactacttcatg
aagatcatgaaggatgtgtggtgtatgagaaggaagaataagatgcctggcttcctctgt
gcccgggtttactcggaaagctacatctccaggcagaccagtgagaccgtcgaaaatgat
aatgcatcgtcctttaccatgtaa

DBGET integrated database retrieval system