KEGG   Mus musculus (mouse): 12469Help
Entry
12469             CDS       T01002                                 

Gene name
Cct8, AI132397, Cctq, Tcpq
Definition
(RefSeq) chaperonin containing Tcp1, subunit 8 (theta)
  KO
K09500  T-complex protein 1 subunit theta
Organism
mmu  Mus musculus (mouse)
Brite
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP60 / Chaperonin
   12469 (Cct8)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   BBS-CCT complex
    12469 (Cct8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cpn60_TCP1
Motif
Other DBs
NCBI-GeneID: 12469
NCBI-ProteinID: NP_033970
MGI: 107183
Ensembl: ENSMUSG00000025613
Vega: OTTMUSG00000040145
UniProt: P42932 Q3UL22 Q8BVY8
Position
16; 16 C3.3
AA seq 548 aa AA seqDB search
MALHVPKAPGFAQMLKDGAKHFSGLEEAVYRNIQACKELAQTTRTAYGPNGMNKMVINRL
EKLFVTNDAATILRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLR
IGLSVSEVISGYEIACKKAHEILPELVCCSAKNLRDVDEVSSLLRTSIMSKQYGSETFLA
KLIAQACVSIFPDSGNFNVDNIRVCKILGSGIYSSSVLHGMVFKKETEGDVTSVKDAKIA
VYSCPFDGMITETKGTVLIKTAEELMNFSKGEENLMDAQVKAIAGTGANVIVTGGKVADI
ALHYANKYNIMLVRLNSKWDLRRLCKTVGATALPKLTPPVQEEMGHCDSVYLSEVGDTQV
VVFKHEKEDGAISTIVLRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIELA
KQITSYGETCPGLEQYAIKKFAEAFEAIPRALAENSGVKANEVISKLYSVHQEGNKNVGL
DIEAEVPAVKDMLEASILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK
DWDDDQND
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttcacgtccccaaggccccgggctttgcccagatgctcaaggatggagccaaa
catttctcgggattagaagaggctgtgtatagaaatatacaggcctgcaaggagcttgct
cagactactcgcacagcgtacggaccaaatggaatgaataaaatggtcatcaatcgcctg
gagaagttgtttgtgacaaacgatgcagcgactattttaagagagctagaagtgcagcat
cctgctgcaaagatgatagtgatggcctctcatatgcaagaacaagaggttggtgatggc
acaaacttcgttctggtgttcgctggggctcttctggaactagctgaagaacttctgagg
attggcctgtcagtatcagaggtaatatcggggtatgaaatagcttgcaaaaaagctcat
gagatccttcctgagttggtatgttgttctgccaaaaaccttcgagatgttgatgaagtg
tcctctctgcttcgaacctccatcatgagtaagcagtacggcagcgagacgtttttggcc
aagcttattgctcaggcttgtgtttctatctttcctgattctggcaatttcaatgttgat
aacatcagagtatgtaagattctgggctctggtatttattcatcctcagtattacatggc
atggtttttaagaaggaaactgaaggtgatgtgacatctgtcaaagatgcaaagatagct
gtgtactcttgtccgtttgatggcatgataacagagacaaaggggaccgtgctgattaag
actgccgaggagctaatgaacttcagtaagggagaggagaacctcatggatgctcaggtg
aaggccattgcaggcactggtgcaaatgtcatagtaacaggcggcaaagtggcggacata
gctcttcattatgctaacaagtacaatatcatgttggtgagactgaactcaaagtgggat
ctcagacgactctgtaaaacagttggtgccacagctcttccaaaattgactcctcccgtc
caagaagaaatgggacattgtgacagtgtttacctctcagaagttggagatacacaagtg
gttgtttttaagcatgaaaaagaagatggtgccatttctactatagttcttcgaggttct
acagacaatctgatggatgacatagaaagggcagtagatgatggagttaatactttcaaa
gttctcacaagggataagcgtcttgtacctggaggtggagctaccgaaattgaattggct
aaacaaatcacatcatatggagagacgtgtcctgggcttgaacagtatgctattaagaag
tttgctgaagcgtttgaagcgattccacgggcactggcagaaaattctggcgtgaaggcc
aatgaagttatctctaaactttattccgtacaccaagaaggaaacaaaaatgtggggttg
gatatcgaggctgaagtccctgctgtaaaggatatgttagaagccagtattttagatact
tacttgggaaaatactgggctattaaactggccactaatgctgcagtcactgtactaaga
gtggatcagatcatcatggcaaaaccagctggtgggcccaaacctccaagtgggaagaag
gactgggatgacgaccagaatgactga

DBGET integrated database retrieval system