KEGG   Mus musculus (mouse): 12475Help
Entry
12475             CDS       T01002                                 

Gene name
Cd14
Definition
(RefSeq) CD14 antigen
  KO
K04391  
CD14 antigen
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
NF-kappa B signaling pathway
Phagosome
Toll-like receptor signaling pathway
Hematopoietic cell lineage
Regulation of actin cytoskeleton
Salmonella infection
Pertussis
Legionellosis
Amoebiasis
Tuberculosis
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    12475 (Cd14)
   04064 NF-kappa B signaling pathway
    12475 (Cd14)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    12475 (Cd14)
  Cell motility
   04810 Regulation of actin cytoskeleton
    12475 (Cd14)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    12475 (Cd14)
   04620 Toll-like receptor signaling pathway
    12475 (Cd14)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    12475 (Cd14)
  Infectious diseases
   05132 Salmonella infection
    12475 (Cd14)
   05133 Pertussis
    12475 (Cd14)
   05134 Legionellosis
    12475 (Cd14)
   05152 Tuberculosis
    12475 (Cd14)
   05146 Amoebiasis
    12475 (Cd14)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   12475 (Cd14)
Cellular antigens [BR:mmu04090]
 Proteins
  12475 (Cd14)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Receptors
  12475 (Cd14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
18 B2; 18 19.46 cM
AA seq 366 aa AA seqDB search
MERVLGLLLLLLVHASPAPPEPCELDEESCSCNFSDPKPDWSSAFNCLGAADVELYGGGR
SLEYLLKRVDTEADLGQFTDIIKSLSLKRLTVRAARIPSRILFGALRVLGISGLQELTLE
NLEVTGTAPPPLLEATGPDLNILNLRNVSWATRDAWLAELQQWLKPGLKVLSIAQAHSLN
FSCEQVRVFPALSTLDLSDNPELGERGLISALCPLKFPTLQVLALRNAGMETPSGVCSAL
AAARVQLQGLDLSHNSLRDAAGAPSCDWPSQLNSLNLSFTGLKQVPKGLPAKLSVLDLSY
NRLDRNPSPDELPQVGNLSLKGNPFLDSESHSEKFNSGVVTAGAPSSQAVALSGTLALLL
GDRLFV
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggagcgtgtgcttggcttgttgctgttgcttctggtgcacgcctctcccgccccacca
gagccctgcgagctagacgaggaaagttgttcctgcaacttctcagatccgaagccagat
tggtccagcgctttcaattgtttgggggcggcagatgtggaattgtacggcggcggccgc
agcctggaataccttctaaagcgtgtggacacggaagcagatctggggcagttcactgat
attatcaagtctctgtccttaaagcggcttacggtgcgggccgcgcggattcctagtcgg
attctattcggagccctgcgtgtgctcgggatttccggcctccaggaactgactcttgaa
aatctcgaggtaaccggcaccgcgccgccaccgcttctggaagccaccggacccgatctc
aacatcttgaacctccgcaacgtgtcgtgggcaacaagggatgcctggctcgcagaactg
cagcagtggctaaagcctggactcaaggtactgagtattgcccaagcacactcgctcaac
ttttcctgcgaacaggtccgcgtcttccctgccctctccaccttagacctgtctgacaat
cctgaattgggcgagagaggactgatctcagccctctgtcccctcaagttcccgaccctc
caagttttagcgctgcgtaacgcggggatggagacgcccagcggcgtgtgctctgcgctg
gccgcagcaagggtacagctgcaaggactagaccttagtcacaattcactgcgggatgct
gcaggcgctccgagttgtgactggcccagtcagctaaactcgctcaatctgtctttcact
gggctgaagcaggtacctaaagggctgccagccaagctcagcgtgctggatctcagttac
aacaggctggataggaaccctagcccagatgagctgccccaagtggggaacctgtcactt
aaaggaaatccctttttggactctgaatcccactcggagaagtttaactctggcgtagtc
accgccggagctccatcatcccaagcagtggccttgtcaggaactctggctttgctccta
ggagatcgcctctttgtttaa

DBGET integrated database retrieval system