KEGG   Mus musculus (mouse): 12478Help
Entry
12478             CDS       T01002                                 

Gene name
Cd19, AW495831
Definition
(RefSeq) CD19 antigen
  KO
K06465  
B-lymphocyte antigen CD19
Organism
mmu  Mus musculus (mouse)
Pathway
PI3K-Akt signaling pathway
Hematopoietic cell lineage
B cell receptor signaling pathway
Epstein-Barr virus infection
Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    12478 (Cd19)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    12478 (Cd19)
   04662 B cell receptor signaling pathway
    12478 (Cd19)
 Human Diseases
  Immune diseases
   05340 Primary immunodeficiency
    12478 (Cd19)
  Infectious diseases
   05169 Epstein-Barr virus infection
    12478 (Cd19)
Cellular antigens [BR:mmu04090]
 Proteins
  12478 (Cd19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 69.01 cM; 7 F3-F4
AA seq 547 aa AA seqDB search
MPSPLPVSFLLFLTLVGGRPQKSLLVEVEEGGNVVLPCLPDSSPVSSEKLAWYRGNQSTP
FLELSPGSPGLGLHVGSLGILLVIVNVSDHMGGFYLCQKRPPFKDIWQPAWTVNVEDSGE
MFRWNASDVRDLDCDLRNRSSGSHRSTSGSQLYVWAKDHPKVWGTKPVCAPRGSSLNQSL
INQDLTVAPGSTLWLSCGVPPVPVAKGSISWTHVHPRRPNVSLLSLSLGGEHPVREMWVW
GSLLLLPQATALDEGTYYCLRGNLTIERHVKVIARSAVWLWLLRTGGWIVPVVTLVYVIF
CMVSLVAFLYCQRAFILRRKRKRMTDPARRFFKVTPPSGNGTQNQYGNVLSLPTSTSGQA
HAQRWAAGLGSVPGSYGNPRIQVQDTGAQSHETGLEEEGEAYEEPDSEEGSEFYENDSNL
GQDQVSQDGSGYENPEDEPMGPEEEDSFSNAESYENADEELAQPVGRMMDFLSPHGSAWD
PSREASSLGSQSYEDMRGILYAAPQLHSIQSGPSHEEDADSYENMDKSDDLEPAWEGEGH
MGTWGTT
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgccatctcctctccctgtctccttcctcctctttcttaccttagtaggaggcaggccc
cagaagtccttactggtggaggtagaagagggaggcaatgttgtgctgccatgcctcccg
gactcctcacctgtctcttctgagaagctggcttggtatcgaggtaaccagtcaacaccc
ttcctggagctgagccccgggtcccctggcctgggattgcacgtggggtccctgggcatc
ttgctagtgattgtcaatgtctcagaccatatggggggcttctacctgtgccagaagagg
ccccctttcaaggacatctggcagcctgcctggacagtgaacgtggaggatagtggggag
atgttccggtggaatgcttcagacgtcagggacctggactgtgacctaaggaacaggtcc
tctgggagccacaggtccacttctggttcccagctgtatgtgtgggctaaagaccatcct
aaggtctggggaacaaagcctgtatgtgcccctcgggggagcagtttgaatcagagtcta
atcaaccaagatctcactgtggcacccggctccacactttggctgtcctgtggggtaccc
cctgtcccagtggccaaaggctccatctcctggacccatgtgcatcctaggagacctaat
gtttcactactgagcctaagccttgggggagagcacccggtcagagagatgtgggtttgg
gggtctcttctgcttctgccccaagccacagctttagatgaaggcacctattattgtctc
cgaggaaacctgaccatcgagaggcacgtgaaggtcattgcaaggtcagcagtgtggctc
tggctgttgagaactggtggatggatagtcccagtggtgactttagtatatgtcatcttc
tgtatggtttctctggtggcttttctctattgtcaaagagcctttatcctgagaaggaaa
aggaagcgaatgactgaccccgccaggagattcttcaaagtgacgcctccctcgggaaac
gggacccagaaccagtacgggaatgtgctctcccttcctacatctacctctggccaggcc
catgctcagcgttgggctgctggcctagggagtgtccctgggtcctatggaaatccacgc
attcaagtccaggatactggagctcagagccatgaaacaggactggaagaagaaggggag
gcctatgaagagccagacagcgaggagggctctgaattctatgagaacgactccaacctt
gggcaggaccaggtttcccaggatgggagtggctatgagaaccccgaggatgagcccatg
ggtccagaggaagaagactccttctccaatgctgagtcttatgaaaatgcagatgaggag
ctggcccaaccagttggcaggatgatggacttcctgagcccccatgggtctgcgtgggac
cccagccgggaagcatcctcgcttgggtcccagtcctatgaagatatgagagggatcctc
tatgcagctcctcagctccactcaattcagtccggtcccagtcatgaagaagatgcagac
tcttatgaaaacatggataagtctgacgacctagaaccagcatgggaaggagagggccac
atggggacttggggaaccacgtga

DBGET integrated database retrieval system