KEGG   Mus musculus (mouse): 12482Help
Entry
12482             CDS       T01002                                 

Gene name
Ms4a1, AA960661, Cd20, Ly-44, Ms4a2
Definition
(RefSeq) membrane-spanning 4-domains, subfamily A, member 1
  KO
K06466  
membrane-spanning 4-domains, subfamily A, member 1
Organism
mmu  Mus musculus (mouse)
Pathway
Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    12482 (Ms4a1)
Cellular antigens [BR:mmu04090]
 Proteins
  12482 (Ms4a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
19 8.19 cM; 19 B
AA seq 291 aa AA seqDB search
MSGPFPAEPTKGPLAMQPAPKVNLKRTSSLVGPTQSFFMRESKALGAVQIMNGLFHITLG
GLLMIPTGVFAPICLSVWYPLWGGIMYIISGSLLAAAAEKTSRKSLVKAKVIMSSLSLFA
AISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSI
QSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEI
IELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgagtggacctttcccagcagagcctacaaaaggtcccctcgccatgcaacctgctcca
aaagtgaacctcaaaaggacatcttcactggtgggccccacacaaagcttcttcatgagg
gaatcaaaggctttgggggctgtccaaatcatgaatggcctcttccatattaccctgggg
ggactgctgatgatccccacaggggtcttcgcacccatctgtttgagtgtatggtaccct
ctctggggaggcattatgtacattatttcaggatcactcctggcagctgcagcagaaaaa
acctccaggaagagtttggtcaaagcaaaagtgataatgagctctctaagcctctttgct
gccatttctggaataattctttcaatcatggacatacttaacatgacactttctcatttt
ttaaaaatgagaagactggagcttattcaaacttccaagccgtatgttgatatctacgac
tgtgaaccatctaattcctcagagaaaaactccccatctacacagtactgtaacagcatt
cagtctgtgttcttgggcattctgtcggcgatgctgatctctgccttcttccagaaactt
gtgacagctggtattgtggagaatgagtggaaaagaatgtgtaccagatccaaatctaat
gtggttctgctgtcagctggagaaaaaaatgagcagacgattaaaatgaaagaagaaatc
attgagctaagtggagtatcttcccaaccaaagaatgaagaggaaattgaaattattcca
gtgcaggaggaagaagaagaagaagcagaaataaattttccagcacctccccaagagcag
gaatccttgccagtggaaaatgagatcgctccttaa

DBGET integrated database retrieval system