KEGG   Mus musculus (mouse): 12494Help
Entry
12494             CDS       T01002                                 

Gene name
Cd38, Cd38-rs1
Definition
CD38 antigen (EC:3.2.2.5)
Orthology
K01242  
ADP-ribosyl cyclase 1 [EC:3.2.2.6 2.4.99.20]
Organism
mmu  Mus musculus (mouse)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Calcium signaling pathway
Hematopoietic cell lineage
Oxytocin signaling pathway
Salivary secretion
Pancreatic secretion
Epstein-Barr virus infection
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:mmu00760]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:mmu04020]
Organismal Systems; Immune system; Hematopoietic cell lineage [PATH:mmu04640]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:mmu04921]
Organismal Systems; Digestive system; Salivary secretion [PATH:mmu04970]
Organismal Systems; Digestive system; Pancreatic secretion [PATH:mmu04972]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:mmu05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5 B3; 5 23.85 cM
AA seq 304 aa AA seqDB search
MANYEFSQVSGDRPGCRLSRKAQIGLGVGLLVLIALVVGIVVILLRPRSLLVWTGEPTTK
HFSDIFLGRCLIYTQILRPEMRDQNCQEILSTFKGAFVSKNPCNITREDYAPLVKLVTQT
IPCNKTLFWSKSKHLAHQYTWIQGKMFTLEDTLLGYIADDLRWCGDPSTSDMNYVSCPHW
SENCPNNPITVFWKVISQKFAEDACGVVQVMLNGSLREPFYKNSTFGSVEVFSLDPNKVH
KLQAWVMHDIEGASSNACSSSSLNELKMIVQKRNMIFACVDNYRPARFLQCVKNPEHPSC
RLNT
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggctaactatgaatttagccaggtgtctggggacagacctggctgccgcctctctagg
aaagcccagatcggtctcggagtgggtctcctggtcctgatcgccttggtagtagggatc
gtggtcatacttctgaggccgcgctcactcctggtgtggactggagagcctaccacgaag
cacttttctgacatcttcctgggacgctgcctcatctacactcagatcctccggccggag
atgagagatcagaactgccaggagatactgagtacattcaaaggagcatttgtttccaag
aacccttgcaacatcacaagagaagactacgccccacttgttaaattggtcactcaaacc
ataccatgtaacaagactctcttttggagcaaatccaaacacctggcccatcaatatact
tggatccagggaaagatgttcaccctggaggacaccctgctgggctacattgctgatgat
ctcaggtggtgtggagaccctagtacttctgatatgaactatgtctcttgcccacattgg
agtgaaaactgtcccaacaaccctattactgtgttctggaaagtgatttcccaaaagttt
gcagaagatgcctgtggtgtggtccaagtgatgctcaatgggtccctccgtgagccattt
tacaaaaacagcacctttggaagtgtggaagtctttagtttggacccaaataaggttcat
aaactacaggcctgggtgatgcacgacatcgaaggagcttccagtaacgcatgttcaagc
tcctccttaaatgagctgaagatgattgtgcagaaaaggaatatgatatttgcctgcgtg
gataactacaggcctgccaggtttcttcagtgtgtgaagaaccctgagcacccatcgtgt
agacttaatacgtga

DBGET integrated database retrieval system