KEGG   Mus musculus (mouse): 12494Help
Entry
12494             CDS       T01002                                 

Gene name
Cd38, ADPRC_1, Cd38-rs1
Definition
CD38 antigen (EC:3.2.2.5)
Orthology
K01242  
ADP-ribosyl cyclase 1 [EC:3.2.2.6 2.4.99.20]
Organism
mmu  Mus musculus (mouse)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Calcium signaling pathway
Hematopoietic cell lineage
Oxytocin signaling pathway
Salivary secretion
Pancreatic secretion
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    12494 (Cd38)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    12494 (Cd38)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    12494 (Cd38)
  Endocrine system
   04921 Oxytocin signaling pathway
    12494 (Cd38)
  Digestive system
   04970 Salivary secretion
    12494 (Cd38)
   04972 Pancreatic secretion
    12494 (Cd38)
 Human Diseases
  Infectious diseases
   05169 Epstein-Barr virus infection
    12494 (Cd38)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.20  2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase
     12494 (Cd38)
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.6  ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase
     12494 (Cd38)
Cellular antigens [BR:mmu04090]
 Proteins
  12494 (Cd38)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5 B3; 5 23.85 cM
AA seq 304 aa AA seqDB search
MANYEFSQVSGDRPGCRLSRKAQIGLGVGLLVLIALVVGIVVILLRPRSLLVWTGEPTTK
HFSDIFLGRCLIYTQILRPEMRDQNCQEILSTFKGAFVSKNPCNITREDYAPLVKLVTQT
IPCNKTLFWSKSKHLAHQYTWIQGKMFTLEDTLLGYIADDLRWCGDPSTSDMNYVSCPHW
SENCPNNPITVFWKVISQKFAEDACGVVQVMLNGSLREPFYKNSTFGSVEVFSLDPNKVH
KLQAWVMHDIEGASSNACSSSSLNELKMIVQKRNMIFACVDNYRPARFLQCVKNPEHPSC
RLNT
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggctaactatgaatttagccaggtgtctggggacagacctggctgccgcctctctagg
aaagcccagatcggtctcggagtgggtctcctggtcctgatcgccttggtagtagggatc
gtggtcatacttctgaggccgcgctcactcctggtgtggactggagagcctaccacgaag
cacttttctgacatcttcctgggacgctgcctcatctacactcagatcctccggccggag
atgagagatcagaactgccaggagatactgagtacattcaaaggagcatttgtttccaag
aacccttgcaacatcacaagagaagactacgccccacttgttaaattggtcactcaaacc
ataccatgtaacaagactctcttttggagcaaatccaaacacctggcccatcaatatact
tggatccagggaaagatgttcaccctggaggacaccctgctgggctacattgctgatgat
ctcaggtggtgtggagaccctagtacttctgatatgaactatgtctcttgcccacattgg
agtgaaaactgtcccaacaaccctattactgtgttctggaaagtgatttcccaaaagttt
gcagaagatgcctgtggtgtggtccaagtgatgctcaatgggtccctccgtgagccattt
tacaaaaacagcacctttggaagtgtggaagtctttagtttggacccaaataaggttcat
aaactacaggcctgggtgatgcacgacatcgaaggagcttccagtaacgcatgttcaagc
tcctccttaaatgagctgaagatgattgtgcagaaaaggaatatgatatttgcctgcgtg
gataactacaggcctgccaggtttcttcagtgtgtgaagaaccctgagcacccatcgtgt
agacttaatacgtga

DBGET integrated database retrieval system