KEGG   Mus musculus (mouse): 12496Help
Entry
12496             CDS       T01002                                 

Gene name
Entpd2, Cd39l1, NTPDase2
Definition
ectonucleoside triphosphate diphosphohydrolase 2 (EC:3.6.1.-)
Orthology
K01509  
adenosinetriphosphatase [EC:3.6.1.3]
Organism
mmu  Mus musculus (mouse)
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    12496 (Entpd2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.3  adenosinetriphosphatase
     12496 (Entpd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 A3; 2
AA seq 495 aa AA seqDB search
MAGKLVSLVPPLLLAAVGLAGLLLLCVPTQDVREPPALKYGIVLDAGSSHTSMFVYKWPA
DKENDTGIVGQHSSCDVRGGGISSYANDPSRAGQSLVECLEQALRDVPKDRYASTPLYLG
ATAGMRLLNLTSPEATAKVLEAVTQTLTRYPFDFRGARILSGQDEGVFGWVTANYLLENF
IKYGWVGRWIRPRKGTLGAMDLGGASTQITFETTSPSEDPDNEVHLRLYGQHYRVYTHSF
LCYGRDQVLQRLLASALQIHRFHPCWPKGYSTQVLLREVYQSPCTMGQRPQTFNSSATVS
LSGTSNAALCRDLVSGLFNISSCPFSQCSFNGVFQPPVAGNFIAFSAFYYTVDFLKTVMG
LPVGTLKQLEDATETTCNQTWAELQARVPGQQTRLPDYCAVAMFIHQLLSRGYRFDERSF
RGVVFEKKAADTAVGWALGYMLNLTNLIPADLPGLRKGTHFSSWVALLLLFTVLILAALV
LLLRQVRSAKSPGAL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggctggaaagttggtgtcactggtgccacccctgctgctggctgccgtgggcctcgcc
ggcctcctgctactgtgcgtccctacccaagacgtccgggagccgcccgccctcaagtat
ggcatcgttctggatgctggctcttcacacacatccatgtttgtctacaagtggccagcg
gacaaggaaaatgacacaggtatcgtgggccagcacagctcttgcgatgttcgaggtggt
ggcatctccagctacgcaaatgacccttctagggcaggccagagtctggttgaatgtctt
gaacaggcacttcgggatgtgcccaaagacagatatgccagcactccactctacctggga
gctacagcaggcatgcgcctactcaacctgaccagcccagaggccacagccaaggtgctg
gaggcagtgacacagacgctcacacggtacccctttgacttccgtggtgcccgcatcctc
tcgggacaggatgaaggggtgtttggctgggtgactgccaactacctgctggagaacttc
atcaagtatggctgggtaggccggtggatacggccaaggaagggaactctgggggccatg
gaccttgggggtgcctcaacacagatcacctttgagacaaccagtccatctgaagatcca
gataatgaggtccatttgcggctctatggccagcattaccgtgtctacacccatagcttc
ctctgctatggccgggaccaggttctccagaggcttctggccagtgccctccagatccat
cgcttccacccctgctggccaaagggctactccacccaagtgctgctccgggaagtctac
cagtctccatgcactatgggtcagcgtccccagaccttcaacagcagtgccactgtcagc
ctgtcagggaccagcaacgctgccctctgtcgtgacctcgtctctgggctcttcaatatc
tcctcctgtcccttttcccaatgctccttcaatggggttttccagcctcccgtggctggg
aacttcatagccttttctgctttctactatactgtagacttcctgaagacagtgatgggg
ctgcctgtgggaaccctgaagcagctggaggatgccacagagaccacctgcaaccagacc
tgggctgagcttcaggcccgagtacccggacagcagacccgcctgcctgactactgcgct
gtagccatgttcatacatcagctattgagccgcggttatcgcttcgacgagcgctctttc
cgtggagtggtcttcgaaaagaaggcggcagacacggctgtcggctgggcgctgggctac
atgctgaatttgaccaacctgattcccgctgacctcccgggactacgtaagggcacccac
ttcagctcctgggttgctctcctgctgctcttcacagtcctgatcttggcggctttggtc
ctgctcttgcgccaggtgcgctctgccaagtccccaggcgccctctag

DBGET integrated database retrieval system