KEGG   Mus musculus (mouse): 12501Help
Entry
12501             CDS       T01002                                 

Gene name
Cd3e, AI504783, CD3, CD3epsilon, T3e
Definition
CD3 antigen, epsilon polypeptide
Orthology
K06451  
T-cell surface glycoprotein CD3 epsilon chain
Organism
mmu  Mus musculus (mouse)
Pathway
Hematopoietic cell lineage
T cell receptor signaling pathway
Chagas disease (American trypanosomiasis)
Measles
HTLV-I infection
Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    12501 (Cd3e)
   04660 T cell receptor signaling pathway
    12501 (Cd3e)
 Human Diseases
  Immune diseases
   05340 Primary immunodeficiency
    12501 (Cd3e)
  Infectious diseases
   05166 HTLV-I infection
    12501 (Cd3e)
   05162 Measles
    12501 (Cd3e)
   05142 Chagas disease (American trypanosomiasis)
    12501 (Cd3e)
Cellular antigens [BR:mmu04090]
 Proteins
  12501 (Cd3e)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9 A5.2; 9 24.84 cM
AA seq 189 aa AA seqDB search
MRWNTFWGILCLSLLAVGTCQDDAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELP
QKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVDLTAVAIIIIVDI
CITLGLLMVIYYWSKNRKAKAKPVTRGTGAGSRPRGQNKERPPPVPNPDYEPIRKGQRDL
YSGLNQRAV
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgcggtggaacactttctggggcatcctgtgcctcagcctcctagctgttggcacttgc
caggacgatgccgagaacattgaatacaaagtctccatctcaggaaccagtgtagagttg
acgtgccctctagacagtgacgagaacttaaaatgggaaaaaaatggccaagagctgcct
cagaagcatgataagcacctggtgctccaggatttctcggaagtcgaggacagtggctac
tacgtctgctacacaccagcctcaaataaaaacacgtacttgtacctgaaagctcgagtg
tgtgagtactgtgtggaggtggacctgacagcagtagccataatcatcattgttgacatc
tgtatcactctgggcttgctgatggtcatttattactggagcaagaataggaaggccaag
gccaagcctgtgacccgaggaaccggtgctggtagcaggcccagagggcaaaacaaggag
cggccaccacctgttcccaacccagactatgagcccatccgcaaaggccagcgggacctg
tattctggcctgaatcagagagcagtctga

DBGET integrated database retrieval system