KEGG   Mus musculus (mouse): 12501Help
Entry
12501             CDS       T01002                                 

Gene name
Cd3e, AI504783, CD3, CD3epsilon, T3e
Definition
(RefSeq) CD3 antigen, epsilon polypeptide
  KO
K06451  
T-cell surface glycoprotein CD3 epsilon chain
Organism
mmu  Mus musculus (mouse)
Pathway
Hematopoietic cell lineage
Th1 and Th2 cell differentiation
Th17 cell differentiation
T cell receptor signaling pathway
Chagas disease (American trypanosomiasis)
Measles
HTLV-I infection
Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    12501 (Cd3e)
   04660 T cell receptor signaling pathway
    12501 (Cd3e)
   04658 Th1 and Th2 cell differentiation
    12501 (Cd3e)
   04659 Th17 cell differentiation
    12501 (Cd3e)
 Human Diseases
  Immune diseases
   05340 Primary immunodeficiency
    12501 (Cd3e)
  Infectious diseases
   05166 HTLV-I infection
    12501 (Cd3e)
   05162 Measles
    12501 (Cd3e)
   05142 Chagas disease (American trypanosomiasis)
    12501 (Cd3e)
Cellular antigens [BR:mmu04090]
 Proteins
  12501 (Cd3e)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9 A5.2; 9 24.84 cM
AA seq 189 aa AA seqDB search
MRWNTFWGILCLSLLAVGTCQDDAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELP
QKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVDLTAVAIIIIVDI
CITLGLLMVIYYWSKNRKAKAKPVTRGTGAGSRPRGQNKERPPPVPNPDYEPIRKGQRDL
YSGLNQRAV
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgcggtggaacactttctggggcatcctgtgcctcagcctcctagctgttggcacttgc
caggacgatgccgagaacattgaatacaaagtctccatctcaggaaccagtgtagagttg
acgtgccctctagacagtgacgagaacttaaaatgggaaaaaaatggccaagagctgcct
cagaagcatgataagcacctggtgctccaggatttctcggaagtcgaggacagtggctac
tacgtctgctacacaccagcctcaaataaaaacacgtacttgtacctgaaagctcgagtg
tgtgagtactgtgtggaggtggacctgacagcagtagccataatcatcattgttgacatc
tgtatcactctgggcttgctgatggtcatttattactggagcaagaataggaaggccaag
gccaagcctgtgacccgaggaaccggtgctggtagcaggcccagagggcaaaacaaggag
cggccaccacctgttcccaacccagactatgagcccatccgcaaaggccagcgggacctg
tattctggcctgaatcagagagcagtctga

DBGET integrated database retrieval system