KEGG   Mus musculus (mouse): 12518Help
Entry
12518             CDS       T01002                                 

Gene name
Cd79a, Ig-alpha, Iga, Igalpha, Ly-54, Ly54, mb-1
Definition
CD79A antigen (immunoglobulin-associated alpha)
Orthology
K06506  
CD79A antigen
Organism
mmu  Mus musculus (mouse)
Pathway
B cell receptor signaling pathway
Primary immunodeficiency
Class
Organismal Systems; Immune system; B cell receptor signaling pathway [PATH:mmu04662]
Human Diseases; Immune diseases; Primary immunodeficiency [PATH:mmu05340]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 A3; 7 13.49 cM
AA seq 220 aa AA seqDB search
MPGGLEALRALPLLLFLSYACLGPGCQALRVEGGPPSLTVNLGEEARLTCENNGRNPNIT
WWFSLQSNITWPPVPLGPGQGTTGQLFFPEVNKNHRGLYWCQVIENNILKRSCGTYLRVR
NPVPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKFGVDMPDDYEDEN
LYEGLNLDDCSMYEDISRGLQGTYQDVGNLHIGDAQLEKP
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgccagggggtctagaagccctcagagccctgcctctcctcctcttcttgtcatacgcc
tgtttgggtcccggatgccaggccctgcgggtagaagggggtccaccatccctgacggtg
aacttgggcgaggaggcccgcctcacctgtgaaaacaatggcaggaaccctaatatcaca
tggtggttcagccttcagtctaacatcacatggcccccagtgccactgggtcctggccag
ggtaccacaggccagctgttcttccccgaagtaaacaagaaccacaggggcttgtactgg
tgccaagtgatagaaaacaacatattaaaacgctcctgtggtacttacctccgcgtgcgc
aatccagtccctaggcccttcctggacatgggggaaggtaccaagaaccgcatcatcaca
gcagaagggatcatcttgctgttctgtgcagtggtgccagggacgctgctgctattcagg
aaacggtggcaaaatgagaagtttggggtggacatgccagatgactatgaagatgaaaat
ctctatgagggcctgaaccttgatgactgttctatgtatgaggacatctccaggggactc
cagggcacctaccaggatgtgggcaacctccacattggagatgcccagctggaaaagcca
tga

DBGET integrated database retrieval system