KEGG   Mus musculus (mouse): 12519Help
Entry
12519             CDS       T01002                                 

Gene name
Cd80, B71, Cd28l, Ly-53, Ly53, MIC17, TSA1
Definition
(RefSeq) CD80 antigen
  KO
K05412  
CD80 antigen
Organism
mmu  Mus musculus (mouse)
Pathway
Cell adhesion molecules (CAMs)
Toll-like receptor signaling pathway
Intestinal immune network for IgA production
Type I diabetes mellitus
Autoimmune thyroid disease
Systemic lupus erythematosus
Rheumatoid arthritis
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    12519 (Cd80)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    12519 (Cd80)
   04672 Intestinal immune network for IgA production
    12519 (Cd80)
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    12519 (Cd80)
   05323 Rheumatoid arthritis
    12519 (Cd80)
   05320 Autoimmune thyroid disease
    12519 (Cd80)
   05330 Allograft rejection
    12519 (Cd80)
   05332 Graft-versus-host disease
    12519 (Cd80)
  Cardiovascular diseases
   05416 Viral myocarditis
    12519 (Cd80)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    12519 (Cd80)
Cell adhesion molecules and their ligands [BR:mmu04516]
 1. Immunoglobulin Superfamily
  Immune system
   B7-CD28 family
    CD28; CD28 antigen [KO:K06470]
     12519 (Cd80)
    CTLA4, CD152; cytotoxic T-lymphocyte-associated protein 4 [KO:K06538]
     12519 (Cd80)
    PDCD1LG1, CD274; programmed cell death 1 ligand 1 [KO:K06745]
     12519 (Cd80)
Cellular antigens [BR:mmu04090]
 Proteins
  12519 (Cd80)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
16 26.86 cM; 16 B5
AA seq 306 aa AA seqDB search
MACNCQLMQDTPLLKFPCPRLILLFVLLIRLSQVSSDVDEQLSKSVKDKVLLPCRYNSPH
EDESEDRIYWQKHDKVVLSVIAGKLKVWPEYKNRTLYDNTTYSLIILGLVLSDRGTYSCV
VQKKERGTYEVKHLALVKLSIKADFSTPNITESGNPSADTKRITCFASGGFPKPRFSWLE
NGRELPGINTTISQDPESELYTISSQLDFNTTRNHTIKCLIKYGDAHVSEDFTWEKPPED
PPDSKNTLVLFGAGFGAVITVVVIVVIIKCFCKHRSCFRRNEASRETNNSLTFGPEEALA
EQTVFL
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcttgcaattgtcagttgatgcaggatacaccactcctcaagtttccatgtccaagg
ctcattcttctctttgtgctgctgattcgtctttcacaagtgtcttcagatgttgatgaa
caactgtccaagtcagtgaaagataaggtattgctgccttgccgttacaactctcctcat
gaagatgagtctgaagaccgaatctactggcaaaaacatgacaaagtggtgctgtctgtc
attgctgggaaactaaaagtgtggcccgagtataagaaccggactttatatgacaacact
acctactctcttatcatcctgggcctggtcctttcagaccggggcacatacagctgtgtc
gttcaaaagaaggaaagaggaacgtatgaagttaaacacttggctttagtaaagttgtcc
atcaaagctgacttctctacccccaacataactgagtctggaaacccatctgcagacact
aaaaggattacctgctttgcttccgggggtttcccaaagcctcgcttctcttggttggaa
aatggaagagaattacctggcatcaatacgacaatttcccaggatcctgaatctgaattg
tacaccattagtagccaactagatttcaatacgactcgcaaccacaccattaagtgtctc
attaaatatggagatgctcacgtgtcagaggacttcacctgggaaaaacccccagaagac
cctcctgatagcaagaacacacttgtgctctttggggcaggattcggcgcagtaataaca
gtcgtcgtcatcgttgtcatcatcaaatgcttctgtaagcacagaagctgtttcagaaga
aatgaggcaagcagagaaacaaacaacagccttaccttcgggcctgaagaagcattagct
gaacagaccgtcttcctttag

DBGET integrated database retrieval system