KEGG   Mus musculus (mouse): 12534Help
Entry
12534             CDS       T01002                                 

Gene name
Cdk1, Cdc2, Cdc2a, p34<CDC2>
Definition
(RefSeq) cyclin-dependent kinase 1
  KO
K02087  cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04115  p53 signaling pathway
mmu04218  Cellular senescence
mmu04540  Gap junction
mmu04914  Progesterone-mediated oocyte maturation
mmu05168  Herpes simplex infection
mmu05169  Epstein-Barr virus infection
mmu05203  Viral carcinogenesis
Module
mmu_M00693  Cell cycle - G2/M transition
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    12534 (Cdk1)
   04114 Oocyte meiosis
    12534 (Cdk1)
   04115 p53 signaling pathway
    12534 (Cdk1)
   04218 Cellular senescence
    12534 (Cdk1)
  Cellular community - eukaryotes
   04540 Gap junction
    12534 (Cdk1)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    12534 (Cdk1)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    12534 (Cdk1)
  Infectious diseases
   05168 Herpes simplex infection
    12534 (Cdk1)
   05169 Epstein-Barr virus infection
    12534 (Cdk1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     12534 (Cdk1)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     12534 (Cdk1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  CDK family
   12534 (Cdk1)
DNA replication proteins [BR:mmu03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    12534 (Cdk1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    12534 (Cdk1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   12534 (Cdk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like Kdo APH Choline_kinase Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 12534
NCBI-ProteinID: NP_031685
MGI: 88351
Ensembl: ENSMUSG00000019942
Vega: OTTMUSG00000031247
UniProt: P11440
Position
10 B5.3; 10 36.07 cM
AA seq 297 aa AA seqDB search
MEDYIKIEKIGEGTYGVVYKGRHRVTGQIVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQFMDSSLVKSYLHQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLVYDPAKRISGKMALKHPYFDDLDNQIKKM
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggaagactatatcaaaatagagaaaattggagaaggtacttacggtgtggtgtataag
ggtagacacagagtcactggccagatagtggccatgaagaagatcagacttgaaagcgag
gaagaaggagtgcccagtactgcaattcgggaaatctctctattaaaagaacttcgacat
ccaaatatagtcagcctgcaggatgtgctcatgcaggactccaggctgtatctcatcttt
gagttcctgtccatggacctcaagaagtacctggactccatccctcctgggcagttcatg
gattcttcactcgttaagagttacttacaccaaatcctccagggaattgtgttttgccac
tcccggcgagttcttcacagagacttgaaacctcaaaatctattgattgatgacaaagga
acaatcaaactggctgatttcggccttgccagagcgtttggaataccgatacgagtgtac
acacacgaggtagtgacgctgtggtaccgatctccagaagtgttgctgggctcggctcgt
tactccactccggttgacatctggagtatagggaccatatttgcagaactggccaccaag
aagccgcttttccacggcgactcagagattgaccagctcttcaggatcttcagagctctg
ggcactcctaacaacgaagtgtggccagaagtcgagtccctgcaggactacaagaacacc
tttcccaagtggaagccggggagcctcgcatcccacgtcaagaacctggacgagaacggc
ttggatttgctctcaaaaatgctagtctatgatcctgccaaacgaatctctggcaaaatg
gccctgaagcacccgtactttgatgacttggacaatcagattaagaagatgtag

DBGET integrated database retrieval system