KEGG   Mus musculus (mouse): 12534Help
Entry
12534             CDS       T01002                                 

Gene name
Cdk1, Cdc2, Cdc2a, p34<CDC2>
Definition
(RefSeq) cyclin-dependent kinase 1 (EC:2.7.11.23 2.7.11.22)
  KO
K02087  
cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
mmu  Mus musculus (mouse)
Pathway
Cell cycle
Oocyte meiosis
p53 signaling pathway
Gap junction
Progesterone-mediated oocyte maturation
Herpes simplex infection
Epstein-Barr virus infection
Viral carcinogenesis
Module
Cell cycle - G2/M transition
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    12534 (Cdk1)
   04114 Oocyte meiosis
    12534 (Cdk1)
   04115 p53 signaling pathway
    12534 (Cdk1)
  Cellular commiunity
   04540 Gap junction
    12534 (Cdk1)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    12534 (Cdk1)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    12534 (Cdk1)
  Infectious diseases
   05168 Herpes simplex infection
    12534 (Cdk1)
   05169 Epstein-Barr virus infection
    12534 (Cdk1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     12534 (Cdk1)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     12534 (Cdk1)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   12534 (Cdk1)
DNA replication proteins [BR:mmu03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    12534 (Cdk1)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    12534 (Cdk1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   12534 (Cdk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
10 B5.3; 10 36.07 cM
AA seq 297 aa AA seqDB search
MEDYIKIEKIGEGTYGVVYKGRHRVTGQIVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQFMDSSLVKSYLHQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLVYDPAKRISGKMALKHPYFDDLDNQIKKM
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggaagactatatcaaaatagagaaaattggagaaggtacttacggtgtggtgtataag
ggtagacacagagtcactggccagatagtggccatgaagaagatcagacttgaaagcgag
gaagaaggagtgcccagtactgcaattcgggaaatctctctattaaaagaacttcgacat
ccaaatatagtcagcctgcaggatgtgctcatgcaggactccaggctgtatctcatcttt
gagttcctgtccatggacctcaagaagtacctggactccatccctcctgggcagttcatg
gattcttcactcgttaagagttacttacaccaaatcctccagggaattgtgttttgccac
tcccggcgagttcttcacagagacttgaaacctcaaaatctattgattgatgacaaagga
acaatcaaactggctgatttcggccttgccagagcgtttggaataccgatacgagtgtac
acacacgaggtagtgacgctgtggtaccgatctccagaagtgttgctgggctcggctcgt
tactccactccggttgacatctggagtatagggaccatatttgcagaactggccaccaag
aagccgcttttccacggcgactcagagattgaccagctcttcaggatcttcagagctctg
ggcactcctaacaacgaagtgtggccagaagtcgagtccctgcaggactacaagaacacc
tttcccaagtggaagccggggagcctcgcatcccacgtcaagaacctggacgagaacggc
ttggatttgctctcaaaaatgctagtctatgatcctgccaaacgaatctctggcaaaatg
gccctgaagcacccgtactttgatgacttggacaatcagattaagaagatgtag

DBGET integrated database retrieval system