KEGG   Mus musculus (mouse): 12537Help
Entry
12537             CDS       T01002                                 

Gene name
Cdk11b, AA989746, CDK11-p110, CDK11-p46, CDK11-p58, Cdc11b, Cdc2l1, Cdc2l2, Cdk11, p58
Definition
(RefSeq) cyclin-dependent kinase 11B (EC:2.7.11.22)
  KO
K08818  
cell division cycle 2-like [EC:2.7.11.22]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     12537 (Cdk11b)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   12537 (Cdk11b)
Spliceosome [BR:mmu03041]
 Complex A
  Other components
   Complex A specific factors
    12537 (Cdk11b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 E2; 4 86.73 cM
AA seq 784 aa AA seqDB search
MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHRMEI
TIRNSPYRREDSMEDRGEEDDSLAIKPPQQMSRKEKAHHRKDEKRKEKRRHRSHSAEGGK
HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERK
LREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREEYSDKGKVGHWSRSPLRPPR
ERFEMGDNRKPVKEEKVEERDLLSDLQDISDSERKTSSAESSSAESGSGSEEEEEEEEEE
EEEEGSTSEESEEEEEEEEEEEEEETGSNSEEASEQSAEEVSDEEMSEDEDRENENHILV
VPESRFDRDSGDSEEGEEEVGEGTPQSSAPTEGDYVPDSPALSPIELKQELPKYLPALQG
CRSVEEFQCLNRIEEGTYGVVYRAKDKKTDEIVALKRLKMEKEKEGFPITSLREINTILK
AQHPNIVTVREIVVGSNMDKIYIVMNYVEHDLKSLMETMKQPFLPGEVKTLMIQLLSGVK
HLHDNWILHRDLKTSNLLLSHAGILKVGDFGLAREYGSPLKAYTPVVVTLWYRAPELLLG
AKEYSTAVDMWSVGCIFGELLTQKPLFPGKSDIDQINKIFKDLGTPSEKIWPGYNDLPAV
KKMTFSEYPYNNLRKRFGALLSDQGFDLMNKFLTYYPGRRINAEDGLKHEYFRETPLPID
PSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHLTTTNQGASAAGPGF
SLKF
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgaaaaggactcttggaaagtgaaaacgttagatgaaattctccaggaaaag
aaacgaaggaaagaacaagaggagaaagcagagataaaacgcttaaaaaattctgatgac
cgcgattccaaaagggattcccttgaggagggggagctgagagatcaccgaatggagatc
acaatcaggaactcaccatatagaagagaggattctatggaagacagaggagaggaggat
gattctctggccatcaaaccaccccagcaaatgtctcggaaagaaaaggctcatcacaga
aaagacgagaaaagaaaagagaaacgtcgacatcgtagccattcagcagagggagggaaa
catgccagagtgaaagagaaagaaagggagcacgaacgccggaaacgccaccgagaagaa
caagataaagctcgaagggagtgggaaagacagaagaggagggaaatggcgagagaacat
tccagaagagagagggaccgcctggagcagttagaaaggaagagggagcgggagcgcaag
ctgagggagcagcagaaggagcagcgggagcagaaggagcgggaacggagggcagaggag
cgccgcaaagagagagaagcgcgtagggaagtctctgcacatcaccgtaccatgagggag
gagtacagtgataaggggaaggttggccactggagccgcagccctctgaggccaccaaga
gagcgctttgagatgggagacaaccggaagccagtaaaagaagagaaggtggaagagaga
gacttgttgtcagacctccaagacatcagtgacagcgagaggaaaaccagctcagctgag
tcttcatcagcagaatcaggctcaggttctgaagaggaggaggaggaagaagaagaggaa
gaagaagaagaagggagcaccagtgaagaatcagaggaagaagaggaagaagaagaggag
gaggaagaagaggagactgggagcaactctgaggaggcctctgaacagtccgcagaagaa
gtcagtgatgaggaaatgagtgaagatgaagacagagaaaacgagaaccacatcttggtt
gttccagagtcacgatttgaccgagattctggggacagtgaagaaggggaggaagaagtt
ggtgaagggactccacagagcagtgcccccaccgaaggagactatgttcctgactctcca
gcactgtcacctattgagctaaaacaagaactgcccaaatacctgccagccctgcaggga
tgcaggagtgtagaggagtttcagtgtctgaacaggattgaagaaggcacctatggggtg
gtctacagagcaaaggacaagaaaacagatgaaattgtggctctgaagcggttaaagatg
gagaaggagaaggaaggcttcccaatcacgtcgctgagggaaatcaacaccatcctcaag
gcccagcaccccaacatcgtcaccgtcagggaaattgttgtgggaagtaacatggacaag
atctacattgtgatgaactacgtggaacatgacctcaagagcctaatggagaccatgaag
cagcccttcctgccaggggaggtgaagaccctgatgattcagctgctgagtggggtaaag
cacctccatgacaattggatcctacaccgtgacctgaagacctctaacctcctgctgagc
catgctggcattctcaaggtgggcgactttgggctggctcgggagtatggttcaccccta
aaggcctacactccagttgttgtaaccctgtggtatcgtgccccagaactactgcttggt
gctaaggaatactccacagctgtggacatgtggtcggtaggctgcatatttggagaactg
ctgacacagaaacctctgttccctgggaagtcagatattgatcagattaacaagattttc
aaggacctgggtactcctagtgagaaaatctggcctggctataatgacctcccagccgtc
aagaagatgaccttcagcgagtatccctataacaacctccgcaagagatttggggctttg
ttatcagatcaaggctttgatctcatgaacaagttcctgacatactaccctggcaggagg
atcaacgcagaagatggcctcaagcacgaatatttccgagagactcccctccccatcgac
ccatccatgttccccacgtggcctgccaagagtgagcagcagagagtgaagcgaggcacg
agtccacggcctcctgagggcggcctgggctacagccagctgggtgatgatgacctgaag
gagacgggcttccacctcaccaccaccaaccagggagcctcagctgcaggccctggcttc
agcctcaagttctga

DBGET integrated database retrieval system