KEGG   Mus musculus (mouse): 12540Help
Entry
12540             CDS       T01002                                 

Gene name
Cdc42, AI747189, AU018915
Definition
(RefSeq) cell division cycle 42
  KO
K04393  cell division control protein 42
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04062  Chemokine signaling pathway
mmu04144  Endocytosis
mmu04360  Axon guidance
mmu04370  VEGF signaling pathway
mmu04510  Focal adhesion
mmu04520  Adherens junction
mmu04530  Tight junction
mmu04660  T cell receptor signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04670  Leukocyte transendothelial migration
mmu04722  Neurotrophin signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu04912  GnRH signaling pathway
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05100  Bacterial invasion of epithelial cells
mmu05132  Salmonella infection
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05205  Proteoglycans in cancer
mmu05211  Renal cell carcinoma
mmu05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    12540 (Cdc42)
   04015 Rap1 signaling pathway
    12540 (Cdc42)
   04010 MAPK signaling pathway
    12540 (Cdc42)
   04370 VEGF signaling pathway
    12540 (Cdc42)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    12540 (Cdc42)
  Cellular community - eukaryotes
   04510 Focal adhesion
    12540 (Cdc42)
   04520 Adherens junction
    12540 (Cdc42)
   04530 Tight junction
    12540 (Cdc42)
  Cell motility
   04810 Regulation of actin cytoskeleton
    12540 (Cdc42)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    12540 (Cdc42)
   04666 Fc gamma R-mediated phagocytosis
    12540 (Cdc42)
   04670 Leukocyte transendothelial migration
    12540 (Cdc42)
   04062 Chemokine signaling pathway
    12540 (Cdc42)
  Endocrine system
   04912 GnRH signaling pathway
    12540 (Cdc42)
  Nervous system
   04722 Neurotrophin signaling pathway
    12540 (Cdc42)
  Development
   04360 Axon guidance
    12540 (Cdc42)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    12540 (Cdc42)
   05205 Proteoglycans in cancer
    12540 (Cdc42)
   05203 Viral carcinogenesis
    12540 (Cdc42)
   05212 Pancreatic cancer
    12540 (Cdc42)
   05211 Renal cell carcinoma
    12540 (Cdc42)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    12540 (Cdc42)
   04933 AGE-RAGE signaling pathway in diabetic complications
    12540 (Cdc42)
  Infectious diseases
   05132 Salmonella infection
    12540 (Cdc42)
   05100 Bacterial invasion of epithelial cells
    12540 (Cdc42)
   05165 Human papillomavirus infection
    12540 (Cdc42)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    12540 (Cdc42)
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    12540 (Cdc42)
  Macropinocytosis
   Ras GTPases
    12540 (Cdc42)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    12540 (Cdc42)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   12540 (Cdc42)
  Exosomal proteins of breast milk
   12540 (Cdc42)
GTP-binding proteins [BR:mmu04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    12540 (Cdc42)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf PET117 GTP_EFTU
Motif
Other DBs
NCBI-GeneID: 12540
NCBI-ProteinID: NP_001230698
MGI: 106211
Ensembl: ENSMUSG00000006699
Vega: OTTMUSG00000009829
UniProt: P60766
Structure
PDB: 

Jmol
Position
4 D3; 4 69.83 cM
AA seq 191 aa AA seqDB search
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQRGLKNVFDEAILAALEPP
ETQPKRKCCIF
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcagacaattaagtgtgttgttgttggtgatggtgctgttggtaaaacatgtctcctg
atatcctacacaacaaacaaattcccatcggaatatgtaccaactgtttttgacaactat
gcagtcacagttatgattggtggagagccatacactcttggactttttgatactgcaggg
caagaggattatgacagactacgaccgctaagttatccacagacagatgtttttctagta
tgtttctcagtggtctctccatcctcatttgaaaatgtgaaagaaaagtgggtgcctgag
ataactcaccactgtccaaagactcctttcttgcttgttgggacccaaattgatctcaga
gatgacccctctactattgagaaacttgccaagaacaaacagaagcctattactccagag
actgctgaaaagctggcgcgggatctgaaggctgtcaagtatgtggagtgctctgccctc
acacagagaggtctgaagaatgtgtttgatgaggctatcctagctgccctcgagcctccg
gaaactcaacccaaaaggaagtgctgtatattctaa

DBGET integrated database retrieval system