KEGG   Mus musculus (mouse): 12540Help
Entry
12540             CDS       T01002                                 

Gene name
Cdc42, AI747189, AU018915
Definition
(RefSeq) cell division cycle 42
  KO
K04393  
cell division control protein 42
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
Endocytosis
Axon guidance
VEGF signaling pathway
Focal adhesion
Adherens junction
Tight junction
T cell receptor signaling pathway
Fc gamma R-mediated phagocytosis
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Regulation of actin cytoskeleton
GnRH signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
AGE-RAGE signaling pathway in diabetic complications
Bacterial invasion of epithelial cells
Salmonella infection
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
Renal cell carcinoma
Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    12540 (Cdc42)
   04015 Rap1 signaling pathway
    12540 (Cdc42)
   04010 MAPK signaling pathway
    12540 (Cdc42)
   04370 VEGF signaling pathway
    12540 (Cdc42)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    12540 (Cdc42)
  Cell motility
   04810 Regulation of actin cytoskeleton
    12540 (Cdc42)
  Cellular commiunity
   04510 Focal adhesion
    12540 (Cdc42)
   04520 Adherens junction
    12540 (Cdc42)
   04530 Tight junction
    12540 (Cdc42)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    12540 (Cdc42)
   04666 Fc gamma R-mediated phagocytosis
    12540 (Cdc42)
   04670 Leukocyte transendothelial migration
    12540 (Cdc42)
   04062 Chemokine signaling pathway
    12540 (Cdc42)
  Endocrine system
   04912 GnRH signaling pathway
    12540 (Cdc42)
  Nervous system
   04722 Neurotrophin signaling pathway
    12540 (Cdc42)
  Development
   04360 Axon guidance
    12540 (Cdc42)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    12540 (Cdc42)
   05205 Proteoglycans in cancer
    12540 (Cdc42)
   05203 Viral carcinogenesis
    12540 (Cdc42)
   05212 Pancreatic cancer
    12540 (Cdc42)
   05211 Renal cell carcinoma
    12540 (Cdc42)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    12540 (Cdc42)
   04933 AGE-RAGE signaling pathway in diabetic complications
    12540 (Cdc42)
  Infectious diseases
   05132 Salmonella infection
    12540 (Cdc42)
   05100 Bacterial invasion of epithelial cells
    12540 (Cdc42)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    12540 (Cdc42)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   12540 (Cdc42)
  Exosomal proteins of breast milk
   12540 (Cdc42)
GTP-binding proteins [BR:mmu04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    12540 (Cdc42)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4 D3; 4 69.83 cM
AA seq 191 aa AA seqDB search
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQRGLKNVFDEAILAALEPP
ETQPKRKCCIF
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcagacaattaagtgtgttgttgttggtgatggtgctgttggtaaaacatgtctcctg
atatcctacacaacaaacaaattcccatcggaatatgtaccaactgtttttgacaactat
gcagtcacagttatgattggtggagagccatacactcttggactttttgatactgcaggg
caagaggattatgacagactacgaccgctaagttatccacagacagatgtttttctagta
tgtttctcagtggtctctccatcctcatttgaaaatgtgaaagaaaagtgggtgcctgag
ataactcaccactgtccaaagactcctttcttgcttgttgggacccaaattgatctcaga
gatgacccctctactattgagaaacttgccaagaacaaacagaagcctattactccagag
actgctgaaaagctggcgcgggatctgaaggctgtcaagtatgtggagtgctctgccctc
acacagagaggtctgaagaatgtgtttgatgaggctatcctagctgccctcgagcctccg
gaaactcaacccaaaaggaagtgctgtatattctaa

DBGET integrated database retrieval system