KEGG   Mus musculus (mouse): 12550Help
Entry
12550             CDS       T01002                                 

Gene name
Cdh1, AA960649, ARC-1, E-cad, Ecad, L-CAM, UVO, Um
Definition
(RefSeq) cadherin 1
  KO
K05689  
cadherin 1, type 1, E-cadherin
Organism
mmu  Mus musculus (mouse)
Pathway
Rap1 signaling pathway
Hippo signaling pathway
Cell adhesion molecules (CAMs)
Adherens junction
Bacterial invasion of epithelial cells
Pathways in cancer
Endometrial cancer
Thyroid cancer
Melanoma
Bladder cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    12550 (Cdh1)
   04390 Hippo signaling pathway
    12550 (Cdh1)
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    12550 (Cdh1)
 Cellular Processes
  Cellular community
   04520 Adherens junction
    12550 (Cdh1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    12550 (Cdh1)
   05216 Thyroid cancer
    12550 (Cdh1)
   05218 Melanoma
    12550 (Cdh1)
   05219 Bladder cancer
    12550 (Cdh1)
   05213 Endometrial cancer
    12550 (Cdh1)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    12550 (Cdh1)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    12550 (Cdh1)
Cell adhesion molecules and their ligands [BR:mmu04516]
 2. Integrin Family
  Beta1 integrins
   VLA-2
    ITGB1; integrin beta 1 [KO:K05719]
     12550 (Cdh1)
  Beta7 integrins
   alpha E beta 7
    ITGB7; integrin beta 7 [KO:K06590]
     12550 (Cdh1)
 5. Cadherin Family
  Classic Cadherins
   Vertebrate Type I classic cadherins
    CDHE, CDH1; cadherin 1, type 1, E-cadherin [KO:K05689]
     12550 (Cdh1)
   Other classic cadherins
    CDH17; cadherin 17, LI cadherin [KO:K06811]
     12550 (Cdh1)
Cellular antigens [BR:mmu04090]
 Proteins
  12550 (Cdh1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8 53.18 cM; 8 D
AA seq 884 aa AA seqDB search
MGARCRSFSALLLLLQVSSWLCQELEPESCSPGFSSEVYTFPVPERHLERGHVLGRVRFE
GCTGRPRTAFFSEDSRFKVATDGTITVKRHLKLHKLETSFLVRARDSSHRELSTKVTLKS
MGHHHHRHHHRDPASESNPELLMFPSVYPGLRRQKRDWVIPPISCPENEKGEFPKNLVQI
KSNRDKETKVFYSITGQGADKPPVGVFIIERETGWLKVTQPLDREAIAKYILYSHAVSSN
GEAVEDPMEIVITVTDQNDNRPEFTQPVFEGFVAEGAVPGTSVMKVSATDADDDVNTYNA
AIAYTIVSQDPELPHKNMFTVNRDTGVISVLTSGLDRESYPTYTLVVQAADLQGEGLSTT
AKAVITVKDINDNAPVFNPSTYQGQVPENEVNARIATLKVTDDDAPNTPAWKAVYTVVND
PDQQFVVVTDPTTNDGILKTAKGLDFEAKQQYILHVRVENEEPFEGSLVPSTATVTVDVV
DVNEAPIFMPAERRVEVPEDFGVGQEITSYTAREPDTFMDQKITYRIWRDTANWLEINPE
TGAIFTRAEMDREDAEHVKNSTYVALIIATDDGSPIATGTGTLLLVLLDVNDNAPIPEPR
NMQFCQRNPQPHIITILDPDLPPNTSPFTAELTHGASVNWTIEYNDAAQESLILQPRKDL
EIGEYKIHLKLADNQNKDQVTTLDVHVCDCEGTVNNCMKAGIVAAGLQVPAILGILGGIL
ALLILILLLLLFLRRRTVVKEPLLPPDDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDA
RPEVTRNDVAPTLMSVPQYRPRPANPDEIGNFIDENLKAADSDPTAPPYDSLLVFDYEGS
GSEAASLSSLNSSESDQDQDYDYLNEWGNRFKKLADMYGGGEDD
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
atgggagcccggtgccgcagcttttccgcgctcctgctcctgctgcaggtctcctcatgg
ctttgccaggagctggagcctgagtcctgcagtcccggcttcagttccgaggtctacacc
ttcccggtgccggagaggcacctggagagaggccatgtcctgggcagagtgagatttgaa
ggatgcactggccggccaaggacagccttcttttcggaagactcccgattcaaagtggcg
acagacggcaccatcacagtgaagcggcatctaaagctccacaagctggagaccagtttc
ctcgtccgcgcccgggactccagtcatagggagctgtctaccaaagtgacgctgaagtcc
atggggcaccaccatcaccggcaccaccaccgcgaccctgcctctgaatccaacccagag
ctgctcatgtttcccagcgtgtacccaggtctcagaagacagaaacgagactgggtcatc
cctcccatcagctgccccgaaaatgaaaagggcgaatttccaaagaacctggttcagatc
aaatccaacagggacaaagaaacaaaggttttctacagcatcaccggccaaggagctgac
aaaccccccgttggcgttttcatcattgagagggagacaggctggctgaaagtgacacag
cctctggatagagaagccattgccaagtacatcctctattctcatgccgtgtcatcaaat
ggggaagcggtggaggatcccatggagatagtgatcacagtgacagatcagaatgacaac
aggccagagtttacccagccggtctttgagggattcgttgcagaaggcgctgttccagga
acctccgtgatgaaggtctcagccaccgatgcagacgatgacgtcaacacctacaacgct
gccatcgcctacaccatcgtcagccaggatcctgagctgcctcacaaaaacatgttcact
gtcaatagggacaccggggtcatcagtgtgctcacctctgggctggaccgagagagttac
cctacatacactctggtggttcaggctgctgaccttcaaggtgaaggcttgagcacaaca
gccaaggctgtgatcactgtcaaggatattaatgacaacgctcctgtcttcaacccaagc
acgtatcagggtcaagtgcctgagaatgaggtcaatgcccggatcgccacactcaaagtg
accgatgatgatgcccccaacactccggcgtggaaagctgtgtacaccgtagtcaacgat
cctgaccagcagttcgttgttgtcacagaccccacgaccaatgatggcattttgaaaaca
gccaagggcttggattttgaggccaagcagcaatacatccttcatgtgagagtggagaac
gaggaaccctttgaggggtctcttgtcccttccacagccactgtcactgtggacgtggta
gacgtgaatgaagcccccatctttatgcctgcggagaggagagtcgaagtgcccgaagac
tttggtgtgggtcaggaaatcacatcttataccgctcgagagccggacacgttcatggat
cagaagatcacgtatcggatttggagggacactgccaactggctggagattaacccagag
actggtgccattttcacgcgcgctgagatggacagagaagacgctgagcatgtgaagaac
agcacatatgtagctctcatcatcgccacagatgatggttcacccattgccactggcacg
ggcactcttctcctggtcctgttagacgtcaatgacaacgctcccatcccagaacctcga
aacatgcagttctgccagaggaacccacagcctcatatcatcaccatcttggatccagac
cttccccccaacacgtccccctttactgctgagctaacccatggggccagcgtcaactgg
accattgagtataatgacgcagctcaagaatctctcattttgcaaccaagaaaggactta
gagattggcgaatacaaaatccatctcaagctcgcggataaccagaacaaagaccaggtg
accacgttggacgtccatgtgtgtgactgtgaagggacggtcaacaactgcatgaaggcg
ggaatcgtggcagcaggattgcaagttcctgccatcctcggaatccttggagggatcctc
gccctgctgattctgatcctgctgctcctactgtttctacggaggagaacggtggtcaaa
gagcccctgctgccaccagatgatgatacccgggacaatgtgtattactatgatgaagaa
ggaggtggagaagaagaccaggactttgatttgagccagctgcacaggggcctggatgcc
cgaccggaagtgactcgaaatgatgtggctcccaccctcatgagcgtgccccagtatcgt
ccccgtcctgccaatcctgatgaaattggaaacttcatcgatgaaaacctgaaggcagcc
gacagcgaccccacggcacccccttacgactctctgttggtgttcgattacgagggcagt
ggttctgaagccgctagcctgagctcactgaactcctctgagtcggatcaggaccaggac
tacgattatctgaacgagtggggcaaccgattcaagaagctggcggacatgtacggcggt
ggtgaggacgactag

DBGET integrated database retrieval system