KEGG   Mus musculus (mouse): 12567Help
Entry
12567             CDS       T01002                                 

Gene name
Cdk4, Crk3
Definition
cyclin-dependent kinase 4 (EC:2.7.11.22)
Orthology
K02089  
cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
mmu  Mus musculus (mouse)
Pathway
Cell cycle
p53 signaling pathway
PI3K-Akt signaling pathway
Tight junction
T cell receptor signaling pathway
Hepatitis B
Measles
HTLV-I infection
Pathways in cancer
Viral carcinogenesis
Pancreatic cancer
Glioma
Melanoma
Bladder cancer
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    12567 (Cdk4)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    12567 (Cdk4)
   04115 p53 signaling pathway
    12567 (Cdk4)
  Cellular commiunity
   04530 Tight junction
    12567 (Cdk4)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    12567 (Cdk4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    12567 (Cdk4)
   05203 Viral carcinogenesis
    12567 (Cdk4)
   05212 Pancreatic cancer
    12567 (Cdk4)
   05214 Glioma
    12567 (Cdk4)
   05220 Chronic myeloid leukemia
    12567 (Cdk4)
   05218 Melanoma
    12567 (Cdk4)
   05219 Bladder cancer
    12567 (Cdk4)
   05222 Small cell lung cancer
    12567 (Cdk4)
   05223 Non-small cell lung cancer
    12567 (Cdk4)
  Infectious diseases
   05166 HTLV-I infection
    12567 (Cdk4)
   05162 Measles
    12567 (Cdk4)
   05161 Hepatitis B
    12567 (Cdk4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     12567 (Cdk4)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   12567 (Cdk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
UniProt: 
Position
10 D3; 10
AA seq 303 aa AA seqDB search
MAATRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGAAGGGLPVSTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDRDIKVTLVFEHIDQDLRTYLDKAPPPGLPVETIKDL
MRQFLSGLDFLHANCIVHRDLKPENILVTSNGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
EVSLPRGAFAPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKEES
DAE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggctgccactcgatatgaacccgtggctgaaattggtgtcggtgcctatgggacggtg
tacaaagcccgagatccccacagtggccactttgtggccctcaagagtgtgagagttcct
aatggaggagcagctggagggggccttcccgtcagcacagttcgtgaggtggccttgtta
aggaggctggaggcctttgaacatcccaatgttgtacggctgatggatgtctgtgctact
tcccgaactgatcgggacatcaaggtcaccctagtgtttgagcatatagaccaggacctg
aggacatacctggacaaagcacctccaccgggcctgccggttgagaccattaaggatcta
atgcgtcagtttctaagcggcctggattttcttcatgcaaactgcattgttcaccgggac
ctgaagccagagaacattctagtgacaagtaatgggaccgtcaagctggctgactttggc
ctagctagaatctacagctaccagatggccctcacgcctgtggtggttacgctctggtac
cgagctcctgaagttcttctgcagtctacatacgcaacacccgtggacatgtggagcgtt
ggctgtatctttgcagagatgttccgtcggaagcctctcttctgtggaaactctgaagcc
gaccagttggggaaaatctttgatctcattggattgcctccagaagacgactggcctcga
gaggtatctctacctcgaggagcctttgcccccagagggcctcggccagtgcagtcagtg
gtgccagagatggaggagtctggagcgcagctgctactggaaatgctgacctttaaccca
cataagcgaatctctgccttccgagccctgcagcactcctacctgcacaaggaggaaagc
gacgcagagtga

DBGET integrated database retrieval system