KEGG   Mus musculus (mouse): 12567Help
Entry
12567             CDS       T01002                                 

Gene name
Cdk4, Crk3
Definition
(RefSeq) cyclin-dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04110  Cell cycle
mmu04115  p53 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04218  Cellular senescence
mmu04530  Tight junction
mmu04660  T cell receptor signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04934  Cushing's syndrome
mmu05161  Hepatitis B
mmu05162  Measles
mmu05165  Human papillomavirus infection
mmu05166  HTLV-I infection
mmu05167  Kaposi's sarcoma-associated herpesvirus infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05212  Pancreatic cancer
mmu05214  Glioma
mmu05218  Melanoma
mmu05219  Bladder cancer
mmu05220  Chronic myeloid leukemia
mmu05222  Small cell lung cancer
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
Module
mmu_M00692  Cell cycle - G1/S transition
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    12567 (Cdk4)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    12567 (Cdk4)
   04115 p53 signaling pathway
    12567 (Cdk4)
   04218 Cellular senescence
    12567 (Cdk4)
  Cellular community - eukaryotes
   04530 Tight junction
    12567 (Cdk4)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    12567 (Cdk4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    12567 (Cdk4)
   05203 Viral carcinogenesis
    12567 (Cdk4)
   05212 Pancreatic cancer
    12567 (Cdk4)
   05225 Hepatocellular carcinoma
    12567 (Cdk4)
   05214 Glioma
    12567 (Cdk4)
   05220 Chronic myeloid leukemia
    12567 (Cdk4)
   05218 Melanoma
    12567 (Cdk4)
   05219 Bladder cancer
    12567 (Cdk4)
   05224 Breast cancer
    12567 (Cdk4)
   05222 Small cell lung cancer
    12567 (Cdk4)
   05223 Non-small cell lung cancer
    12567 (Cdk4)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    12567 (Cdk4)
   04934 Cushing's syndrome
    12567 (Cdk4)
  Infectious diseases
   05166 HTLV-I infection
    12567 (Cdk4)
   05162 Measles
    12567 (Cdk4)
   05161 Hepatitis B
    12567 (Cdk4)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    12567 (Cdk4)
   05165 Human papillomavirus infection
    12567 (Cdk4)
  Drug resistance
   01522 Endocrine resistance
    12567 (Cdk4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     12567 (Cdk4)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  CDK family
   12567 (Cdk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Haspin_kinase Kdo Kinase-like
Motif
Other DBs
NCBI-GeneID: 12567
NCBI-ProteinID: NP_034000
MGI: 88357
Ensembl: ENSMUSG00000006728
Vega: OTTMUSG00000030604
UniProt: P30285 Q545C3
Position
10; 10 D3
AA seq 303 aa AA seqDB search
MAATRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGAAGGGLPVSTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDRDIKVTLVFEHIDQDLRTYLDKAPPPGLPVETIKDL
MRQFLSGLDFLHANCIVHRDLKPENILVTSNGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
EVSLPRGAFAPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKEES
DAE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggctgccactcgatatgaacccgtggctgaaattggtgtcggtgcctatgggacggtg
tacaaagcccgagatccccacagtggccactttgtggccctcaagagtgtgagagttcct
aatggaggagcagctggagggggccttcccgtcagcacagttcgtgaggtggccttgtta
aggaggctggaggcctttgaacatcccaatgttgtacggctgatggatgtctgtgctact
tcccgaactgatcgggacatcaaggtcaccctagtgtttgagcatatagaccaggacctg
aggacatacctggacaaagcacctccaccgggcctgccggttgagaccattaaggatcta
atgcgtcagtttctaagcggcctggattttcttcatgcaaactgcattgttcaccgggac
ctgaagccagagaacattctagtgacaagtaatgggaccgtcaagctggctgactttggc
ctagctagaatctacagctaccagatggccctcacgcctgtggtggttacgctctggtac
cgagctcctgaagttcttctgcagtctacatacgcaacacccgtggacatgtggagcgtt
ggctgtatctttgcagagatgttccgtcggaagcctctcttctgtggaaactctgaagcc
gaccagttggggaaaatctttgatctcattggattgcctccagaagacgactggcctcga
gaggtatctctacctcgaggagcctttgcccccagagggcctcggccagtgcagtcagtg
gtgccagagatggaggagtctggagcgcagctgctactggaaatgctgacctttaaccca
cataagcgaatctctgccttccgagccctgcagcactcctacctgcacaaggaggaaagc
gacgcagagtga

DBGET integrated database retrieval system