KEGG   Mus musculus (mouse): 12567Help
Entry
12567             CDS       T01002                                 

Gene name
Cdk4, Crk3
Definition
cyclin-dependent kinase 4 (EC:2.7.11.22)
Orthology
K02089  
cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
mmu  Mus musculus (mouse)
Pathway
Cell cycle
p53 signaling pathway
PI3K-Akt signaling pathway
Tight junction
T cell receptor signaling pathway
Hepatitis B
Measles
HTLV-I infection
Pathways in cancer
Viral carcinogenesis
Pancreatic cancer
Glioma
Melanoma
Bladder cancer
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:mmu04151]
Cellular Processes; Cell growth and death; Cell cycle [PATH:mmu04110]
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:mmu04115]
Cellular Processes; Cell communication; Tight junction [PATH:mmu04530]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:mmu04660]
Human Diseases; Cancers; Pathways in cancer [PATH:mmu05200]
Human Diseases; Cancers; Viral carcinogenesis [PATH:mmu05203]
Human Diseases; Cancers; Pancreatic cancer [PATH:mmu05212]
Human Diseases; Cancers; Glioma [PATH:mmu05214]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:mmu05220]
Human Diseases; Cancers; Melanoma [PATH:mmu05218]
Human Diseases; Cancers; Bladder cancer [PATH:mmu05219]
Human Diseases; Cancers; Small cell lung cancer [PATH:mmu05222]
Human Diseases; Cancers; Non-small cell lung cancer [PATH:mmu05223]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:mmu05166]
Human Diseases; Infectious diseases; Measles [PATH:mmu05162]
Human Diseases; Infectious diseases; Hepatitis B [PATH:mmu05161]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
UniProt: 
Position
10 D3; 10
AA seq 303 aa AA seqDB search
MAATRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGAAGGGLPVSTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDRDIKVTLVFEHIDQDLRTYLDKAPPPGLPVETIKDL
MRQFLSGLDFLHANCIVHRDLKPENILVTSNGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
EVSLPRGAFAPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKEES
DAE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggctgccactcgatatgaacccgtggctgaaattggtgtcggtgcctatgggacggtg
tacaaagcccgagatccccacagtggccactttgtggccctcaagagtgtgagagttcct
aatggaggagcagctggagggggccttcccgtcagcacagttcgtgaggtggccttgtta
aggaggctggaggcctttgaacatcccaatgttgtacggctgatggatgtctgtgctact
tcccgaactgatcgggacatcaaggtcaccctagtgtttgagcatatagaccaggacctg
aggacatacctggacaaagcacctccaccgggcctgccggttgagaccattaaggatcta
atgcgtcagtttctaagcggcctggattttcttcatgcaaactgcattgttcaccgggac
ctgaagccagagaacattctagtgacaagtaatgggaccgtcaagctggctgactttggc
ctagctagaatctacagctaccagatggccctcacgcctgtggtggttacgctctggtac
cgagctcctgaagttcttctgcagtctacatacgcaacacccgtggacatgtggagcgtt
ggctgtatctttgcagagatgttccgtcggaagcctctcttctgtggaaactctgaagcc
gaccagttggggaaaatctttgatctcattggattgcctccagaagacgactggcctcga
gaggtatctctacctcgaggagcctttgcccccagagggcctcggccagtgcagtcagtg
gtgccagagatggaggagtctggagcgcagctgctactggaaatgctgacctttaaccca
cataagcgaatctctgccttccgagccctgcagcactcctacctgcacaaggaggaaagc
gacgcagagtga

DBGET integrated database retrieval system