KEGG   Mus musculus (mouse): 12613Help
Entry
12613             CDS       T01002                                 

Gene name
Cel, 1810036E18Rik, BAL
Definition
(RefSeq) carboxyl ester lipase (EC:3.1.1.13 3.1.1.3)
  KO
K12298  
bile salt-stimulated lipase [EC:3.1.1.3 3.1.1.13]
Organism
mmu  Mus musculus (mouse)
Pathway
Steroid biosynthesis
Glycerolipid metabolism
Metabolic pathways
Pancreatic secretion
Fat digestion and absorption
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    12613 (Cel)
   00561 Glycerolipid metabolism
    12613 (Cel)
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    12613 (Cel)
   04975 Fat digestion and absorption
    12613 (Cel)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     12613 (Cel)
    3.1.1.13  sterol esterase
     12613 (Cel)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   12613 (Cel)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 A3; 2 19.38 cM
AA seq 599 aa AA seqDB search
MGRLEVLFLGLTCCLAAACAAKLGAVYTEGGFVEGVNKKLSLLGGDSVDIFKGIPFATAK
TLENPQRHPGWQGTLKATNFKKRCLQATITQDNTYGQEDCLYLNIWVPQGRKQVSHNLPV
MVWIYGGAFLMGSGQGANFLKNYLYDGEEIATRGNVIVVTFNYRVGPLGFLSTGDANLPG
NFGLRDQHMAIAWVKRNIAAFGGDPDNITIFGESAGAASVSLQTLSPYNKGLIRRAISQS
GMALSPWAIQKNPLFWAKTIAKKVGCPTEDTGKMAACLKITDPRALTLAYKLPVKKQEYP
VVHYLAFIPVIDGDFIPDDPINLYNNTADIDYIAGINNMDGHLFATIDVPAVDKTKQTVT
EEDFYRLVSGHTVAKGLKGAQATFDIYTESWAQDPSQENMKKTVVAFETDVLFLIPTEIA
LAQHKAHAKSAKTYSYLFSHPSRMPIYPKWMGADHADDLQYVFGKPFATPLGYRPQDRAV
SKAMIAYWTNFARSGDPNMGNSPVPTHWYPYTLENGNYLDITKTITSASMKEHLREKFLK
FWAVTFEVLPTVTGDQDTLTPPEDDSEVAPDPPSDDSQVVPVPPTDDSVEAQMPATIGF
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atggggcgcctggaggttctatttcttggcctcacctgctgcttggcagcggcttgtgct
gcaaagttgggggctgtgtacacagaaggcggtttcgtggagggcgtcaacaagaagctc
agtctcttgggtggtgactctgttgacatcttcaagggcatcccctttgccactgccaag
accttggagaatcctcagcgtcaccctggctggcaagggacgctgaaggctacaaacttc
aagaaacgatgcctacaggccaccatcacccaggacaacacctatgggcaagaagactgc
ctctacctcaatatctgggtgccccagggcaggaagcaggtgtcccacaacctgcctgtg
atggtctggatctatggaggtgccttcctcatgggatctggccaaggggccaattttctc
aaaaactacctgtatgacggggaggagatcgccactcggggcaacgtcattgtggtcacc
ttcaactaccgtgttggacccttgggtttccttagcaccggggatgctaaccttccaggt
aactttggtcttcgagatcagcacatggctatcgcctgggtgaagaggaacattgcagcc
tttgggggggaccctgataacatcaccatctttggggaatctgctggagctgccagtgtc
tccctgcagaccctctccccatacaacaagggtctcatccggagagccatcagtcagagt
ggtatggcactgagcccctgggccatccagaagaacccacttttctgggccaaaacgatt
gctaagaaggtaggatgccccacagaggatactggcaagatggctgcgtgtctgaagatc
acagatccccgggccttgacactggcctacaagttgcccgtgaaaaagcaggagtaccct
gttgtgcactacctggccttcatccctgtcatcgatggtgacttcattcccgatgatccc
atcaacctgtacaacaacactgctgacattgactacatagcgggcattaacaacatggac
ggccacctatttgctaccattgatgtgcccgctgtcgacaagaccaagcagactgtcacc
gaggaggacttctacaggctagtcagtggacacactgtcgccaaggggctgaagggggcc
caagccacctttgacatctacactgagtcctgggcccaggacccgtcccaggagaacatg
aagaagacagtggtggcctttgagactgatgtactcttcctgatccccacggagatagcg
ctggcccagcacaaagcccatgccaagagcgccaagacctattcttacctgttttcccac
ccttcacggatgcctatctaccccaaatggatgggggcagaccatgctgatgacctccag
tacgtctttggaaagccttttgccaccccactgggctaccggccccaagatagggctgtc
tccaaggccatgatcgcctattggaccaactttgccaggagtggggaccccaacatgggc
aactcacctgtgcccacacactggtacccttataccttggagaatggcaactacctggac
atcactaagacgataaccagcgcttccatgaaggagcacctgagagaaaagttcctgaag
ttctgggctgtgacattcgaggtgctgcccacagtgactggtgaccaggacaccctcact
ccccctgaggatgactcagaggttgcccctgacccaccttcagacgactcccaggttgtt
cctgtcccacctacagatgactctgtggaggctcagatgcctgccaccattggcttctaa

DBGET integrated database retrieval system