KEGG   Mus musculus (mouse): 12623Help
Entry
12623             CDS       T01002                                 

Gene name
Ces1g, Ces-1, Ces1, Ses-1
Definition
(RefSeq) carboxylesterase 1G
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase Abhydrolase_3 Esterase Say1_Mug180 Peptidase_S9
Motif
Other DBs
NCBI-GeneID: 12623
NCBI-ProteinID: NP_067431
MGI: 88378
Ensembl: ENSMUSG00000057074
Vega: OTTMUSG00000040118
UniProt: Q8VCC2 Q3UW56
Position
8 C5; 8 45.29 cM
AA seq 565 aa AA seqDB search
MWLCALSLISLTACLSLGHPSLPPVVHTVHGKVLGKYVTLEGFSQPVAVFLGVPFAKPPL
GSLRFAPPEPAEPWSFVKHTTSYPPLCYQNPEAALRLAELFTNQRKIIPHKFSEDCLYLN
IYTPADLTQNSRLPVMVWIHGGGLVIDGASTYDGVPLAVHENVVVVVIQYRLGIWGFFST
EDEHSRGNWGHLDQVAALHWVQDNIANFGGNPGSVTIFGESAGGESVSVLVLSPLAKNLF
HRAIAQSSVIFNPCLFGRAARPLAKKIAALAGCKTTTSAAMVHCLRQKTEDELLEVSLKM
KFGTVDFLGDPRESYPFLPTVIDGVLLPKAPEEILAEKSFNTVPYMVGINKHEFGWIIPM
FLDFPLSERKLDQKTAASILWQAYPILNISEKLIPAAIEKYLGGTEDPATMTDLFLDLIG
DIMFGVPSVIVSRSHRDAGAPTYMYEYQYRPSFVSDDRPQELLGDHADELFSVWGAPFLK
EGASEEEINLSKMVMKFWANFARNGNPNGEGLPHWPEYDQKEGYLQIGVPAQAAHRLKDK
EVDFWTELRAKETAERSSHREHVEL
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgtggctctgtgctttgagtctgatctctctcactgcttgcttgagtctgggacaccca
tccttaccgcctgtggtacacaccgttcatggcaaagtcctggggaagtatgtcacctta
gaaggattctcacagcctgtggccgtcttcctgggagtcccctttgccaagccccctctt
ggatctctgaggtttgctccaccagagcctgcagagccctggagcttcgtgaagcacacc
acttcctaccctcctttgtgctaccaaaacccagaggcagcattgaggctcgctgagctc
ttcaccaaccaaaggaagatcattccccacaaattttctgaggactgtctctacctcaac
atttatactcctgctgacttaacacagaacagcaggttgcccgtgatggtgtggatacat
ggaggtggacttgtgatagatggagcatcaacctatgatggagtgcccctcgctgtccat
gaaaatgtggttgtagtggtcattcagtatcgcctgggcatctggggattcttcagcaca
gaggatgaacacagccgggggaactggggtcacttggaccaggtggctgcactacattgg
gtccaagacaacattgccaactttgggggcaacccaggatctgtgactatcttcggcgag
tcagcaggaggtgaaagtgtctctgttcttgtgttaagcccactggccaagaacctcttc
cacagggccatcgctcagagtagtgtcattttcaatccttgcctttttgggagagctgcc
agacccttggctaagaaaattgctgctcttgctggctgtaaaaccaccacctccgctgcc
atggttcactgcctgcgccagaagactgaagatgagctcttggaggtctcactgaaaatg
aaatttgggactgttgattttcttggagaccccagagagagctatcccttcctccctact
gtgattgatggagtgttgctgccaaaggcaccagaagagattctggctgagaagagtttc
aacactgtcccctacatggtgggcatcaacaagcatgagtttggctggatcattccaatg
tttttggacttcccactctctgaaagaaaactggaccagaagacagctgcatccatcctg
tggcaggcctacccaattcttaacatctctgaaaagctgattccagcagctattgaaaag
tatttaggagggacagaagaccctgccacaatgacagacctgttcctggacttgattgga
gacattatgttcggtgtcccatctgtaatcgtgtcccgtagtcacagagatgctggagcc
ccaacctacatgtatgaatatcagtatcgcccaagttttgtatcagacgatagaccccag
gaattgttaggagaccacgctgatgaactcttttctgtatggggagccccgtttttaaaa
gagggtgcttcagaagaagagatcaacctcagcaagatggtgatgaaattctgggccaac
tttgctcggaatgggaaccctaatggtgaagggctgcctcattggccagaatatgaccag
aaggaaggataccttcagattggagtcccagcacaggcagcccataggctgaaagacaag
gaagtggacttttggactgagctcagagccaaggaaacagcagagaggtcatcccatagg
gaacatgttgaactgtga

DBGET integrated database retrieval system