KEGG   Mus musculus (mouse): 12638Help
Entry
12638             CDS       T01002                                 

Gene name
Cftr, AW495489, Abcc7
Definition
(RefSeq) cystic fibrosis transmembrane conductance regulator
  KO
K05031  cystic fibrosis transmembrane conductance regulator [EC:3.6.3.49]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu02010  ABC transporters
mmu04024  cAMP signaling pathway
mmu04152  AMPK signaling pathway
mmu04530  Tight junction
mmu04971  Gastric acid secretion
mmu04972  Pancreatic secretion
mmu04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    12638 (Cftr)
  Signal transduction
   04024 cAMP signaling pathway
    12638 (Cftr)
   04152 AMPK signaling pathway
    12638 (Cftr)
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    12638 (Cftr)
 Organismal Systems
  Digestive system
   04971 Gastric acid secretion
    12638 (Cftr)
   04972 Pancreatic secretion
    12638 (Cftr)
   04976 Bile secretion
    12638 (Cftr)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.49  channel-conductance-controlling ATPase
     12638 (Cftr)
Transporters [BR:mmu02000]
 ABC Transporters, Eukaryotic Type
  ABCC (CFTR/MRP) subfamily
   ABCC7 subgroup
    12638 (Cftr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CFTR_R ABC_membrane ABC_tran AAA_21 T2SSE SMC_N AAA_29 DUF87 AAA_16 NTPase_1 AAA_22 RsgA_GTPase MMR_HSR1 AAA_23 AAA_30 NACHT ArgK NB-ARC Zeta_toxin MobB cobW
Motif
Other DBs
NCBI-GeneID: 12638
NCBI-ProteinID: NP_066388
MGI: 88388
Ensembl: ENSMUSG00000041301
Vega: OTTMUSG00000024173
UniProt: P26361
Structure
PDB: 

Jmol
Position
6 A2; 6 8.1 cM
AA seq 1476 aa AA seqDB search
MQKSPLEKASFISKLFFSWTTPILRKGYRHHLELSDIYQAPSADSADHLSEKLEREWDRE
QASKKNPQLIHALRRCFFWRFLFYGILLYLGEVTKAVQPVLLGRIIASYDPENKVERSIA
IYLGIGLCLLFIVRTLLLHPAIFGLHRIGMQMRTAMFSLIYKKTLKLSSRVLDKISIGQL
VSLLSNNLNKFDEGLALAHFIWIAPLQVTLLMGLLWDLLQFSAFCGLGLLIILVIFQAIL
GKMMVKYRDQRAAKINERLVITSEIIDNIYSVKAYCWESAMEKMIENLREVELKMTRKAA
YMRFFTSSAFFFSGFFVVFLSVLPYTVINGIVLRKIFTTISFCIVLRMSVTRQFPTAVQI
WYDSFGMIRKIQDFLQKQEYKVLEYNLMTTGIIMENVTAFWEEGFGELLEKVQQSNGDRK
HSSDENNVSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEG
IIKHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTV
LGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTR
ILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSLRPDFSSKLMGYDTFDQFTEERRSS
ILTETLRRFSVDDSSAPWSKPKQSFRQTGEVGEKRKNSILNSFSSVRKISIVQKTPLCID
GESDDLQEKRLSLVPDSEQGEAALPRSNMIATGPTFPGRRRQSVLDLMTFTPNSGSSNLQ
RTRTSIRKISLVPQISLNEVDVYSRRLSQDSTLNITEEINEEDLKECFLDDVIKIPPVTT
WNTYLRYFTLHKGLLLVLIWCVLVFLVEVAASLFVLWLLKNNPVNSGNNGTKISNSSYVV
IITSTSFYYIFYIYVGVADTLLALSLFRGLPLVHTLITASKILHRKMLHSILHAPMSTIS
KLKAGGILNRFSKDIAILDDFLPLTIFDFIQLVFIVIGAIIVVSALQPYIFLATVPGLVV
FILLRAYFLHTAQQLKQLESEGRSPIFTHLVTSLKGLWTLRAFRRQTYFETLFHKALNLH
TANWFMYLATLRWFQMRIDMIFVLFFIVVTFISILTTGEGEGTAGIILTLAMNIMSTLQW
AVNSSIDTDSLMRSVSRVFKFIDIQTEESMYTQIIKELPREGSSDVLVIKNEHVKKSDIW
PSGGEMVVKDLTVKYMDDGNAVLENISFSISPGQRVGLLGRTGSGKSTLLSAFLRMLNIK
GDIEIDGVSWNSVTLQEWRKAFGVITQKVFIFSGTFRQNLDPNGKWKDEEIWKVADEVGL
KSVIEQFPGQLNFTLVDGGYVLSHGHKQLMCLARSVLSKAKIILLDEPSAHLDPITYQVI
RRVLKQAFAGCTVILCEHRIEAMLDCQRFLVIEESNVWQYDSLQALLSEKSIFQQAISSS
EKMRFFQGRHSSKHKPRTQITALKEETEEEVQETRL
NT seq 4431 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagtcgcctttggagaaagccagctttatctccaaactcttcttcagctggacc
acaccaattttgaggaaagggtacagacaccacttggagttgtcagacatataccaagcc
ccttctgctgattcagctgaccacttgtctgaaaaactagaaagagaatgggacagagaa
caagcttcaaaaaagaatccccagcttatccacgcccttcggcgatgctttttctggaga
ttcctcttctatggaattttgctatacctaggggaagtcaccaaggctgtccagcctgtc
ttgctaggaagaatcatagcatcctatgatccagaaaacaaggtggaacgttccattgcc
atttaccttggcataggcttatgccttctcttcattgtcaggacactgcttcttcaccca
gctatttttggccttcatcgcattggaatgcagatgagaacagctatgtttagcttgatt
tataagaagactttaaagttgtcaagccgcgttcttgataaaataagtattggacaactt
gttagtcttctttccaacaacctgaacaaatttgatgaaggacttgccttggcacatttt
atatggattgctcctttacaagtgactcttctgatggggcttctctgggacttgttacag
ttctcagccttctgtggccttggtttactgataatcctggttatttttcaagctatccta
gggaagatgatggtgaagtacagagatcagagagctgcaaagatcaatgaaagactcgtg
atcacatcagaaattattgataatatctattctgttaaggcatattgttgggaatcagcg
atggagaaaatgattgaaaacttgagagaggtggagctgaaaatgacccggaaggcggcc
tatatgaggttcttcactagctctgccttcttcttttcagggttctttgtagtctttcta
tctgtgcttccctacacagtcatcaacggaatcgtcctacgaaaaatattcacaaccatt
tcattctgcattgtcctacgtatgtcagtcacacggcagttccccactgccgtacagata
tggtatgattcttttggaatgataagaaaaatacaggatttcctgcagaaacaagagtat
aaagtactggagtataacttaatgaccacaggcataatcatggaaaatgtaacagcattt
tgggaggagggatttggggaattactggagaaagtacaacaaagcaatggtgacagaaaa
cattccagtgatgagaacaatgtcagtttcagtcatctctgccttgtgggaaatcctgtg
ctgaaaaacatcaatttgaatatagagaaaggagagatgttggctattactggatctact
ggatcaggaaagacatcactcctgatgttgattttgggagaactggaagcttcagaggga
attattaagcacagtggaagagtttcattctgctctcaattttcttggattatgccgggt
actatcaaagaaaatatcatctttggtgtttcctatgatgagtacagatataagagtgtt
gtcaaagcttgccaactacagcaggacatcaccaagtttgcagaacaagacaacacagtt
cttggagaaggtggagtcacactgagtggaggtcagcgtgcaaggatttctttagcaaga
gcagtatataaagatgctgatttgtacctattagattccccttttggatatctagatgtt
tttactgaagaacaagtatttgaaagctgtgtttgtaaattgatggccaacaaaactagg
attttggttacatctaaaatggaacacttaaggaaagctgacaaaatactaattttgcat
cagggcagtagctatttttatgggacattttctgagctacaaagtctacgtccagacttc
agttcgaaactcatggggtatgatacttttgaccagtttactgaggaaagaagaagttca
attctaactgagaccttacgcaggttctcagtagacgattcctctgccccgtggagcaaa
cccaaacagtcgtttagacagactggagaggtgggagaaaaaaggaagaactctattcta
aattcattcagctctgtaaggaaaatttccattgtgcaaaagactccattatgtatcgat
ggagagtctgatgatctccaagaaaagagactgtccctagttccggattctgaacagggg
gaggctgctctgccgcgcagcaacatgatcgccaccggccccacatttccaggcagaaga
agacagtctgttttggatctgatgacgttcacacccaactcaggctccagcaatcttcag
aggaccagaacttctattcgaaaaatctccttagtccctcagataagcttaaatgaagtg
gatgtatattcaaggagattatcgcaagatagcacactgaacatcactgaagaaattaac
gaagaagatttaaaggagtgttttcttgatgatgtgatcaagatacccccggtgacaaca
tggaacacatacctacgatattttactctccataaaggcttactgctagtgctgatttgg
tgcgtactggtttttctggttgaggtggctgcttctttatttgtgttatggttgcttaaa
aacaaccctgttaacagtggaaacaatggtactaaaatttccaatagctcctatgttgtg
atcatcaccagtaccagtttctattatattttttacatttacgtgggagtggctgacact
ttgcttgccctgagcctcttcagaggtttgccgctggtgcatacgttaatcacagcatca
aaaattttgcacaggaaaatgttacactccattcttcacgcccctatgtcgaccatcagc
aagctgaaagcaggtgggattcttaacagattctccaaagatatagcaattttggatgac
tttctgcctcttaccatttttgacttcattcagttggtgttcattgtgattggagctata
atagtcgtctcggcattacaaccctacatcttcctagcaacggtgccagggctagtagtc
tttattttactgagggcctacttccttcatacagcacagcagctcaaacaactggaatct
gaaggcaggagtccaattttcacccaccttgtgacaagcttaaaaggactctggacactt
cgagccttccgacgccagacttactttgaaactctgttccacaaagctctgaatttgcac
actgccaactggtttatgtatctggcaaccttgcgctggttccaaatgagaatagacatg
atatttgtcctcttcttcattgttgttaccttcatctccattttaacaacaggtgaagga
gaaggaacagctggtattattctaactttagctatgaatatcatgagtactttgcagtgg
gctgtgaactcaagcattgatacagatagcttgatgcgatctgtgagcagagtgtttaag
tttattgatatacaaacagaagaaagtatgtacacacagataattaaagaactacctaga
gaaggatcatctgacgttttagtcattaagaatgagcatgtgaagaaaagtgatatctgg
ccctctggaggcgaaatggttgtcaaagaccttactgtgaaatacatggatgatggaaat
gccgtattagagaacatttctttttcaataagtcctggacagagggtggggctcttagga
agaactggatcaggaaaaagtactttgctttcagcatttttacgaatgttgaacattaaa
ggtgatatagagattgatggtgtctcatggaattcagtgaccttacaagaatggaggaaa
gctttcggagtgataacacagaaagtatttatcttttctggaacattcagacaaaacctg
gatcccaatggaaaatggaaagatgaagaaatatggaaagttgcagatgaggttggactc
aagtctgtaatagagcagtttcctggacagctcaactttacccttgtggatgggggttat
gtgctaagccatggccataagcaattaatgtgcttggcccgatcagttctcagtaaggcc
aagatcatactgcttgatgagcccagtgcccatctagaccccataacataccaagtcatt
cgacgagttctaaaacaagccttcgctggttgcacagtcatcctctgtgaacacaggata
gaagcgatgttggattgccagcgatttttggtcatagaagagagcaatgtctggcagtac
gactcccttcaggcacttctgagtgagaagagtatcttccagcaggccattagctcctcg
gaaaagatgaggttcttccagggccgccactccagcaagcacaagcctcggacgcaaatt
actgctctgaaagaggagacagaagaagaagttcaagaaacccgtctctag

DBGET integrated database retrieval system