KEGG   Mus musculus (mouse): 12638Help
Entry
12638             CDS       T01002                                 

Gene name
Cftr, AW495489, Abcc7
Definition
(RefSeq) cystic fibrosis transmembrane conductance regulator
  KO
K05031  
cystic fibrosis transmembrane conductance regulator [EC:3.6.3.49]
Organism
mmu  Mus musculus (mouse)
Pathway
ABC transporters
cAMP signaling pathway
AMPK signaling pathway
Tight junction
Gastric acid secretion
Pancreatic secretion
Bile secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    12638 (Cftr)
  Signal transduction
   04024 cAMP signaling pathway
    12638 (Cftr)
   04152 AMPK signaling pathway
    12638 (Cftr)
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    12638 (Cftr)
 Organismal Systems
  Digestive system
   04971 Gastric acid secretion
    12638 (Cftr)
   04972 Pancreatic secretion
    12638 (Cftr)
   04976 Bile secretion
    12638 (Cftr)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.49  channel-conductance-controlling ATPase
     12638 (Cftr)
Transporters [BR:mmu02000]
 ABC Transporters, Eukaryotic Type
  ABCC (CFTR/MRP) subfamily
   ABCC7 subgroup
    12638 (Cftr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6 A2; 6 8.1 cM
AA seq 1476 aa AA seqDB search
MQKSPLEKASFISKLFFSWTTPILRKGYRHHLELSDIYQAPSADSADHLSEKLEREWDRE
QASKKNPQLIHALRRCFFWRFLFYGILLYLGEVTKAVQPVLLGRIIASYDPENKVERSIA
IYLGIGLCLLFIVRTLLLHPAIFGLHRIGMQMRTAMFSLIYKKTLKLSSRVLDKISIGQL
VSLLSNNLNKFDEGLALAHFIWIAPLQVTLLMGLLWDLLQFSAFCGLGLLIILVIFQAIL
GKMMVKYRDQRAAKINERLVITSEIIDNIYSVKAYCWESAMEKMIENLREVELKMTRKAA
YMRFFTSSAFFFSGFFVVFLSVLPYTVINGIVLRKIFTTISFCIVLRMSVTRQFPTAVQI
WYDSFGMIRKIQDFLQKQEYKVLEYNLMTTGIIMENVTAFWEEGFGELLEKVQQSNGDRK
HSSDENNVSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEG
IIKHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTV
LGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTR
ILVTSKMEHLRKADKILILHQGSSYFYGTFSELQSLRPDFSSKLMGYDTFDQFTEERRSS
ILTETLRRFSVDDSSAPWSKPKQSFRQTGEVGEKRKNSILNSFSSVRKISIVQKTPLCID
GESDDLQEKRLSLVPDSEQGEAALPRSNMIATGPTFPGRRRQSVLDLMTFTPNSGSSNLQ
RTRTSIRKISLVPQISLNEVDVYSRRLSQDSTLNITEEINEEDLKECFLDDVIKIPPVTT
WNTYLRYFTLHKGLLLVLIWCVLVFLVEVAASLFVLWLLKNNPVNSGNNGTKISNSSYVV
IITSTSFYYIFYIYVGVADTLLALSLFRGLPLVHTLITASKILHRKMLHSILHAPMSTIS
KLKAGGILNRFSKDIAILDDFLPLTIFDFIQLVFIVIGAIIVVSALQPYIFLATVPGLVV
FILLRAYFLHTAQQLKQLESEGRSPIFTHLVTSLKGLWTLRAFRRQTYFETLFHKALNLH
TANWFMYLATLRWFQMRIDMIFVLFFIVVTFISILTTGEGEGTAGIILTLAMNIMSTLQW
AVNSSIDTDSLMRSVSRVFKFIDIQTEESMYTQIIKELPREGSSDVLVIKNEHVKKSDIW
PSGGEMVVKDLTVKYMDDGNAVLENISFSISPGQRVGLLGRTGSGKSTLLSAFLRMLNIK
GDIEIDGVSWNSVTLQEWRKAFGVITQKVFIFSGTFRQNLDPNGKWKDEEIWKVADEVGL
KSVIEQFPGQLNFTLVDGGYVLSHGHKQLMCLARSVLSKAKIILLDEPSAHLDPITYQVI
RRVLKQAFAGCTVILCEHRIEAMLDCQRFLVIEESNVWQYDSLQALLSEKSIFQQAISSS
EKMRFFQGRHSSKHKPRTQITALKEETEEEVQETRL
NT seq 4431 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagtcgcctttggagaaagccagctttatctccaaactcttcttcagctggacc
acaccaattttgaggaaagggtacagacaccacttggagttgtcagacatataccaagcc
ccttctgctgattcagctgaccacttgtctgaaaaactagaaagagaatgggacagagaa
caagcttcaaaaaagaatccccagcttatccacgcccttcggcgatgctttttctggaga
ttcctcttctatggaattttgctatacctaggggaagtcaccaaggctgtccagcctgtc
ttgctaggaagaatcatagcatcctatgatccagaaaacaaggtggaacgttccattgcc
atttaccttggcataggcttatgccttctcttcattgtcaggacactgcttcttcaccca
gctatttttggccttcatcgcattggaatgcagatgagaacagctatgtttagcttgatt
tataagaagactttaaagttgtcaagccgcgttcttgataaaataagtattggacaactt
gttagtcttctttccaacaacctgaacaaatttgatgaaggacttgccttggcacatttt
atatggattgctcctttacaagtgactcttctgatggggcttctctgggacttgttacag
ttctcagccttctgtggccttggtttactgataatcctggttatttttcaagctatccta
gggaagatgatggtgaagtacagagatcagagagctgcaaagatcaatgaaagactcgtg
atcacatcagaaattattgataatatctattctgttaaggcatattgttgggaatcagcg
atggagaaaatgattgaaaacttgagagaggtggagctgaaaatgacccggaaggcggcc
tatatgaggttcttcactagctctgccttcttcttttcagggttctttgtagtctttcta
tctgtgcttccctacacagtcatcaacggaatcgtcctacgaaaaatattcacaaccatt
tcattctgcattgtcctacgtatgtcagtcacacggcagttccccactgccgtacagata
tggtatgattcttttggaatgataagaaaaatacaggatttcctgcagaaacaagagtat
aaagtactggagtataacttaatgaccacaggcataatcatggaaaatgtaacagcattt
tgggaggagggatttggggaattactggagaaagtacaacaaagcaatggtgacagaaaa
cattccagtgatgagaacaatgtcagtttcagtcatctctgccttgtgggaaatcctgtg
ctgaaaaacatcaatttgaatatagagaaaggagagatgttggctattactggatctact
ggatcaggaaagacatcactcctgatgttgattttgggagaactggaagcttcagaggga
attattaagcacagtggaagagtttcattctgctctcaattttcttggattatgccgggt
actatcaaagaaaatatcatctttggtgtttcctatgatgagtacagatataagagtgtt
gtcaaagcttgccaactacagcaggacatcaccaagtttgcagaacaagacaacacagtt
cttggagaaggtggagtcacactgagtggaggtcagcgtgcaaggatttctttagcaaga
gcagtatataaagatgctgatttgtacctattagattccccttttggatatctagatgtt
tttactgaagaacaagtatttgaaagctgtgtttgtaaattgatggccaacaaaactagg
attttggttacatctaaaatggaacacttaaggaaagctgacaaaatactaattttgcat
cagggcagtagctatttttatgggacattttctgagctacaaagtctacgtccagacttc
agttcgaaactcatggggtatgatacttttgaccagtttactgaggaaagaagaagttca
attctaactgagaccttacgcaggttctcagtagacgattcctctgccccgtggagcaaa
cccaaacagtcgtttagacagactggagaggtgggagaaaaaaggaagaactctattcta
aattcattcagctctgtaaggaaaatttccattgtgcaaaagactccattatgtatcgat
ggagagtctgatgatctccaagaaaagagactgtccctagttccggattctgaacagggg
gaggctgctctgccgcgcagcaacatgatcgccaccggccccacatttccaggcagaaga
agacagtctgttttggatctgatgacgttcacacccaactcaggctccagcaatcttcag
aggaccagaacttctattcgaaaaatctccttagtccctcagataagcttaaatgaagtg
gatgtatattcaaggagattatcgcaagatagcacactgaacatcactgaagaaattaac
gaagaagatttaaaggagtgttttcttgatgatgtgatcaagatacccccggtgacaaca
tggaacacatacctacgatattttactctccataaaggcttactgctagtgctgatttgg
tgcgtactggtttttctggttgaggtggctgcttctttatttgtgttatggttgcttaaa
aacaaccctgttaacagtggaaacaatggtactaaaatttccaatagctcctatgttgtg
atcatcaccagtaccagtttctattatattttttacatttacgtgggagtggctgacact
ttgcttgccctgagcctcttcagaggtttgccgctggtgcatacgttaatcacagcatca
aaaattttgcacaggaaaatgttacactccattcttcacgcccctatgtcgaccatcagc
aagctgaaagcaggtgggattcttaacagattctccaaagatatagcaattttggatgac
tttctgcctcttaccatttttgacttcattcagttggtgttcattgtgattggagctata
atagtcgtctcggcattacaaccctacatcttcctagcaacggtgccagggctagtagtc
tttattttactgagggcctacttccttcatacagcacagcagctcaaacaactggaatct
gaaggcaggagtccaattttcacccaccttgtgacaagcttaaaaggactctggacactt
cgagccttccgacgccagacttactttgaaactctgttccacaaagctctgaatttgcac
actgccaactggtttatgtatctggcaaccttgcgctggttccaaatgagaatagacatg
atatttgtcctcttcttcattgttgttaccttcatctccattttaacaacaggtgaagga
gaaggaacagctggtattattctaactttagctatgaatatcatgagtactttgcagtgg
gctgtgaactcaagcattgatacagatagcttgatgcgatctgtgagcagagtgtttaag
tttattgatatacaaacagaagaaagtatgtacacacagataattaaagaactacctaga
gaaggatcatctgacgttttagtcattaagaatgagcatgtgaagaaaagtgatatctgg
ccctctggaggcgaaatggttgtcaaagaccttactgtgaaatacatggatgatggaaat
gccgtattagagaacatttctttttcaataagtcctggacagagggtggggctcttagga
agaactggatcaggaaaaagtactttgctttcagcatttttacgaatgttgaacattaaa
ggtgatatagagattgatggtgtctcatggaattcagtgaccttacaagaatggaggaaa
gctttcggagtgataacacagaaagtatttatcttttctggaacattcagacaaaacctg
gatcccaatggaaaatggaaagatgaagaaatatggaaagttgcagatgaggttggactc
aagtctgtaatagagcagtttcctggacagctcaactttacccttgtggatgggggttat
gtgctaagccatggccataagcaattaatgtgcttggcccgatcagttctcagtaaggcc
aagatcatactgcttgatgagcccagtgcccatctagaccccataacataccaagtcatt
cgacgagttctaaaacaagccttcgctggttgcacagtcatcctctgtgaacacaggata
gaagcgatgttggattgccagcgatttttggtcatagaagagagcaatgtctggcagtac
gactcccttcaggcacttctgagtgagaagagtatcttccagcaggccattagctcctcg
gaaaagatgaggttcttccagggccgccactccagcaagcacaagcctcggacgcaaatt
actgctctgaaagaggagacagaagaagaagttcaagaaacccgtctctag

DBGET integrated database retrieval system