KEGG   Mus musculus (mouse): 12649Help
Entry
12649             CDS       T01002                                 

Gene name
Chek1, C85740, Chk1, rad27
Definition
(RefSeq) checkpoint kinase 1
  KO
K02216  
serine/threonine-protein kinase Chk1 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Cell cycle
p53 signaling pathway
Cellular senescence
HTLV-I infection
Viral carcinogenesis
Module
DNA damage-induced cell cycle checkpoints
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    12649 (Chek1)
   04115 p53 signaling pathway
    12649 (Chek1)
   04218 Cellular senescence
    12649 (Chek1)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    12649 (Chek1)
  Infectious diseases
   05166 HTLV-I infection
    12649 (Chek1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     12649 (Chek1)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   12649 (Chek1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    12649 (Chek1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
9; 9 A4
AA seq 476 aa AA seqDB search
MAVPFVEDWDLVQTLGEGAYGEVQLAVNRITEEAVAVKIVDMKRAIDCPENIKKEICINK
MLSHENVVKFYGHRREGHIQYLFLEYCSGGELFDRIEPDIGMPEQDAQRFFHQLMAGVVY
LHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRHNNRERLLNKMCGTLPYVAPELLK
RKEFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLA
LLHKILVETPSARITIPDIKKDRWYNKPLNRGAKRPRATSGGMSESSSGFSKHIHSNLDF
SPVNNGSSEETVKFSSSQPEPRTGLSLWDTGPSNVDKLVQGISFSQPTCPEHMLVNSQLL
GTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETFEKLGYQWKKSCMNQVTVSTTDRR
NNKLIFKINLVEMDEKILVDFRLSKGDGLEFKRHFLKIKGKLSDVVSSQKVWFPVT
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgccttttgtggaagactgggatttggtgcaaactttgggagaaggtgcctat
ggagaagttcaacttgctgtgaatagaataactgaagaagctgttgcagtgaaaattgta
gacatgaagcgggccatagactgtccagaaaatattaagaaagagatctgcatcaataaa
atgttaagccacgagaatgtagtgaaattctatggccacaggagggaaggccatatccag
tatctgtttctggagtactgtagtggaggagaactttttgatagaattgagccagacata
gggatgcctgaacaagatgctcagaggttcttccaccaactcatggcaggggtggtttat
cttcatggaattggaataactcacagggatattaaaccagaaaacctcctcttggatgaa
agggataacctcaaaatctctgactttggcttggcaacggtatttcggcataataatcgt
gaacgcttactgaacaagatgtgtgggactttaccttatgttgctccggagcttctaaag
agaaaagaatttcatgcagaaccagttgatgtttggtcctgtggaatagtacttactgca
atgttggctggagaattgccgtgggaccagcccagtgatagctgtcaggaatattctgat
tggaaagaaaaaaaaacctatctcaatccttggaaaaaaattgattctgctcctctggct
ttgcttcataaaattctagttgagactccatcagcaaggatcaccatcccagacattaag
aaagatagatggtacaacaaaccacttaacagaggagcaaagaggccacgcgccacatca
ggtggtatgtcagagtcttctagtggattctctaagcacattcattccaatttggacttt
tctccagtaaataatggttccagtgaagaaaccgtgaagttctctagttcccagccagag
ccgagaacagggctttccttgtgggacactggtccctcgaacgtggacaaactggttcag
ggcatcagtttttcccagcctacgtgtcctgagcatatgcttgtaaacagtcagttactc
ggtacccctggatcttcacagaacccctggcagcgcttggtcaaaaggatgacacgattc
tttactaaattggatgcggacaaatcttaccaatgcctgaaagagaccttcgagaagttg
ggctatcagtggaagaagagttgtatgaatcaggttactgtatcaacaactgatagaaga
aacaataagttgattttcaaaataaatttggtagaaatggatgagaagatactggttgac
ttccgactttctaagggtgatggattagagttcaagagacacttcctgaagattaaaggg
aagctcagcgatgttgtgagcagccagaaggtttggtttcctgttacatga

DBGET integrated database retrieval system