KEGG   Mus musculus (mouse): 12649Help
Entry
12649             CDS       T01002                                 

Gene name
Chek1, C85740, Chk1, rad27
Definition
(RefSeq) checkpoint kinase 1 (EC:2.7.11.1)
  KO
K02216  
serine/threonine-protein kinase Chk1 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Cell cycle
p53 signaling pathway
HTLV-I infection
Viral carcinogenesis
Module
DNA damage-induced cell cycle checkpoints
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    12649 (Chek1)
   04115 p53 signaling pathway
    12649 (Chek1)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    12649 (Chek1)
  Infectious diseases
   05166 HTLV-I infection
    12649 (Chek1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     12649 (Chek1)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   12649 (Chek1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    12649 (Chek1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
9; 9 A5.3
AA seq 476 aa AA seqDB search
MAVPFVEDWDLVQTLGEGAYGEVQLAVNRITEEAVAVKIVDMKRAIDCPENIKKEICINK
MLSHENVVKFYGHRREGHIQYLFLEYCSGGELFDRIEPDIGMPEQDAQRFFHQLMAGVVY
LHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRHNNRERLLNKMCGTLPYVAPELLK
RKEFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLA
LLHKILVETPSARITIPDIKKDRWYNKPLNRGAKRPRATSGGMSESSSGFSKHIHSNLDF
SPVNNGSSEETVKFSSSQPEPRTGLSLWDTGPSNVDKLVQGISFSQPTCPEHMLVNSQLL
GTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETFEKLGYQWKKSCMNQVTVSTTDRR
NNKLIFKINLVEMDEKILVDFRLSKGDGLEFKRHFLKIKGKLSDVVSSQKVWFPVT
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgccttttgtggaagactgggatttggtgcaaactttgggagaaggtgcctat
ggagaagttcaacttgctgtgaatagaataactgaagaagctgttgcagtgaaaattgta
gacatgaagcgggccatagactgtccagaaaatattaagaaagagatctgcatcaataaa
atgttaagccacgagaatgtagtgaaattctatggccacaggagggaaggccatatccag
tatctgtttctggagtactgtagtggaggagaactttttgatagaattgagccagacata
gggatgcctgaacaagatgctcagaggttcttccaccaactcatggcaggggtggtttat
cttcatggaattggaataactcacagggatattaaaccagaaaacctcctcttggatgaa
agggataacctcaaaatctctgactttggcttggcaacggtatttcggcataataatcgt
gaacgcttactgaacaagatgtgtgggactttaccttatgttgctccggagcttctaaag
agaaaagaatttcatgcagaaccagttgatgtttggtcctgtggaatagtacttactgca
atgttggctggagaattgccgtgggaccagcccagtgatagctgtcaggaatattctgat
tggaaagaaaaaaaaacctatctcaatccttggaaaaaaattgattctgctcctctggct
ttgcttcataaaattctagttgagactccatcagcaaggatcaccatcccagacattaag
aaagatagatggtacaacaaaccacttaacagaggagcaaagaggccacgcgccacatca
ggtggtatgtcagagtcttctagtggattctctaagcacattcattccaatttggacttt
tctccagtaaataatggttccagtgaagaaaccgtgaagttctctagttcccagccagag
ccgagaacagggctttccttgtgggacactggtccctcgaacgtggacaaactggttcag
ggcatcagtttttcccagcctacgtgtcctgagcatatgcttgtaaacagtcagttactc
ggtacccctggatcttcacagaacccctggcagcgcttggtcaaaaggatgacacgattc
tttactaaattggatgcggacaaatcttaccaatgcctgaaagagaccttcgagaagttg
ggctatcagtggaagaagagttgtatgaatcaggttactgtatcaacaactgatagaaga
aacaataagttgattttcaaaataaatttggtagaaatggatgagaagatactggttgac
ttccgactttctaagggtgatggattagagttcaagagacacttcctgaagattaaaggg
aagctcagcgatgttgtgagcagccagaaggtttggtttcctgttacatga

DBGET integrated database retrieval system