KEGG   Mus musculus (mouse): 12651Help
Entry
12651             CDS       T01002                                 

Gene name
Chkb, Chetk, Chkl, Ck, Ck/Ek, Ck/Ek-beta, Ckb, Ckekb, Ek
Definition
choline kinase beta (EC:2.7.1.32 2.7.1.82)
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    12651 (Chkb)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     12651 (Chkb)
    2.7.1.82  ethanolamine kinase
     12651 (Chkb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
15 E3; 15
AA seq 394 aa AA seqDB search
MAADGTGVVGGGAVGGGLPKDGLQDAKCPEPIPNRRRASSLSRDAQRRAYQWCREYLGGA
WRRARPEELSVCPVSGGLSNLLFRCSLPNHVPSVGGEPREVLLRLYGAILQGVDSLVLES
VMFAILAERSLGPQLYGVFPEGRLEQYLPSRPLKTQELRDPVLSGAIATRMARFHGMEMP
FTKEPRWLFGTMERYLKQIQDLPSTSLPQMNLVEMYSLKDEMNSLRKLLDDTPSPVVFCH
NDIQEGNILLLSEPDSDDNLMLVDFEYSSYNYRGFDIGNHFCEWVYDYTYEEWPFYKARP
TDYPTREQQLHFIRHYLAEVQKGEILSEEEQKKREEELLLEISRYSLASHFFWGLWSTLQ
ASMSTIEFGYLEYAQSRFQFYFQQKGQLTSSPSS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagacgggacaggggtagtcggaggaggggctgtcggcggcggcctgcccaag
gacggtttgcaggatgctaagtgcccagagccaatccccaatcggcggcgcgcttcctcg
ctgtcccgtgacgcgcagcgccgagcctatcagtggtgccgggagtacctgggcggggcc
tggcgccgagcgcggccggaggagctgagcgtttgtcccgtgagcggaggcctcagcaac
ctgctcttccgatgctcactaccgaaccacgtacccagtgtgggcggggagccccgggag
gtgctgctacgactctacggggccatcctgcagggtgtagactccttggtattagaaagc
gtgatgttcgccattctcgcagagcggtctctagggccccagctttacggagtgtttcca
gagggccgcttggaacagtacctcccaagccggccgttgaaaactcaagagctccgggac
ccagtgttgtcgggagccattgcaacgaggatggcccgtttccatggtatggagatgccc
ttcactaaggagccccgatggttgtttgggaccatggagcggtacctgaagcagatccag
gacttgccttccaccagccttccccagatgaacctggtagagatgtacagcctcaaggac
gagatgaacagcctcaggaagttactagacgataccccgtcaccagtggtcttctgccac
aatgacatccaggaaggaaacatcttgttgctttcagagccagacagtgatgataacctc
atgttggttgattttgagtacagtagttataactacaggggctttgacattgggaatcat
ttttgtgagtgggtttatgattatacttatgaagaatggcctttctacaaagcaagaccc
acggactaccccactagagaacagcagctccattttattcgccattatctggcagaggtt
cagaagggtgagatcctctccgaagaggaacagaagaaacgggaagaagaattgctgcta
gagatcagtcggtactccctggcatctcactttttctggggtctgtggtccaccctgcag
gcttcgatgtccactatagagttcggctacttggagtatgcccaatctcggttccagttc
tacttccagcagaagggccagctgacgagttccccatcatcctga

DBGET integrated database retrieval system