KEGG   Mus musculus (mouse): 12660Help
Entry
12660             CDS       T01002                                 

Gene name
Chka, CK, CK/EK-alpha, Chetk-alpha, Chk, ChoK, EK, EtnK-alpha
Definition
(RefSeq) choline kinase alpha
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00564  Glycerophospholipid metabolism
mmu01100  Metabolic pathways
mmu05231  Choline metabolism in cancer
Module
mmu_M00090  Phosphatidylcholine (PC) biosynthesis, choline => PC
mmu_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    12660 (Chka)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    12660 (Chka)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     12660 (Chka)
    2.7.1.82  ethanolamine kinase
     12660 (Chka)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH EcKinase Kdo Helo_like_N
Motif
Other DBs
NCBI-GeneID: 12660
NCBI-ProteinID: NP_001258425
MGI: 107760
Ensembl: ENSMUSG00000024843
Vega: OTTMUSG00000029650
UniProt: O54804
Position
19 A; 19 3.57 cM
AA seq 453 aa AA seqDB search
MKTKFCTGGEAEPSPLGLLLSCGGNAAPTPGVGQQRDAAGELESKQLGGRTQPLALPPPP
PPPLPLPPPPSPPLADEQPEPRTRRRAYLWCKEFLPGAWRGLREDQFHISVIRGGLSNML
FQCSLPDSIASVGDEPRKVLLRLYGAILKMRSCNKEGSEQAQNENEFQGAEAMVLESVMF
AILAERSLGPKLFGIFPQGRLEQFIPSRRLDTEELRLPDISAEIAEKMATFHGMKMPFNK
EPKWLFGTMEKYLNQVLRLKFSREARVQQLHKILSYNLPLELENLRSLLQYTRSPVVFCH
NDCQEGNILLLEGQENSERRKLMLIDFEYSSYNYRGFDIGNHFCEWMYDYTYEKYPFFRA
NIQKYPSRKQQLHFISSYLTTFQNDFESLSSEEQFATKEDMLLEVNRFALASHFLWGLWS
IVQAKISSIEFGYMEYAQARFEAYFDQKRKLGV
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaagttctgcaccgggggcgaggccgagccgtcgcctctcgggctgctgctg
agctgcggtggcaacgctgccccgacgcccggcgtagggcagcagcgggacgccgcaggc
gagctggagtccaagcagcttggtggccgaacccaacctctcgcgctgccgccgccgccg
ccgccgcccctgccgctgcccccgccgccatcaccgccgctagcggacgaacaacccgag
ccccggaccaggcgcagggcctacctgtggtgtaaggaattcctgcccggagcctggcga
ggccttcgcgaggaccagttccacatcagtgtcatcaggggtggtctcagtaacatgctg
ttccagtgctccctgccagactccatagccagcgttggcgatgagcctcggaaagtgctc
ttgcggctctatggggcaatcttaaagatgaggtcctgtaataaagagggatccgaacaa
gctcagaatgaaaatgaatttcaaggggctgaggcgatggttctggagagtgttatgttt
gccattcttgcagagaggtcacttgggccaaaactctttggcatctttccccaaggccga
ctggagcagtttatcccgagccggcgattggacactgaagagttacgtttaccagatatt
tctgcagaaatagctgagaaaatggccacatttcatggtatgaaaatgccattcaataag
gaaccaaaatggctttttggaacaatggaaaaatacctgaatcaagtactaagactcaaa
ttcagcagggaggccagagttcagcaactgcacaagatcctctcttacaacctgcctctt
gagctcgagaacctgaggtcattgctgcagtatactagatctccagttgtattttgtcat
aatgactgtcaagaaggtaatatcttattgttggaaggccaggagaactctgaaaggcgg
aagctgatgcttattgactttgagtacagcagttacaattacaggggatttgacattgga
aatcatttctgtgaatggatgtatgattatacctatgagaagtatcctttcttcagagcg
aacattcagaagtatccttcccgaaaacaacagctccattttatttccagttacttgact
acattccaaaatgattttgaaagcctcagtagtgaagagcagtttgctacaaaagaagac
atgttgcttgaagtcaacagatttgctcttgcctctcatttcctctggggactttggtcc
attgtacaggccaagatctcatccattgaatttgggtacatggaatatgcccaagccaga
ttcgaggcctactttgaccagaagaggaagcttggggtgtga

DBGET integrated database retrieval system