KEGG   Mus musculus (mouse): 12669Help
Entry
12669             CDS       T01002                                 

Gene name
Chrm1, Chrm-1, M1, M1R
Definition
(RefSeq) cholinergic receptor, muscarinic 1, CNS
  KO
K04129  muscarinic acetylcholine receptor M1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04024  cAMP signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04725  Cholinergic synapse
mmu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    12669 (Chrm1)
   04024 cAMP signaling pathway
    12669 (Chrm1)
   04151 PI3K-Akt signaling pathway
    12669 (Chrm1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    12669 (Chrm1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    12669 (Chrm1)
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    12669 (Chrm1)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Acetylcholine (muscarinic) [OT]
    12669 (Chrm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srbc 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 12669
NCBI-ProteinID: NP_001106167
MGI: 88396
Ensembl: ENSMUSG00000032773
Vega: OTTMUSG00000039794
UniProt: P12657
Position
19; 19 A
AA seq 460 aa AA seqDB search
MNTSVPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS
SERSQPGAEGSPESPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV
VIKMPMVDPEAQAPTKQPPKSSPNTVKRPTKKGRDRGGKGQKPRGKEQLAKRKTFSLVKE
KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTVNPMCYAL
CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaacacctcagtgccccctgctgtcagtcccaacatcaccgtcttggcaccaggaaag
ggtccctggcaagtggcattcatcgggatcaccacaggcctcctgtctctggctacagtg
acaggcaacctgctggtgctcatctccttcaaggtcaacacagagctcaagacagtcaac
aactacttcctgctgagcctggcctgtgctgatctcatcattggcactttctccatgaac
ctctataccacatacctgctcatgggccactgggctctgggcacactggcctgtgacctc
tggctggccctggactatgtggccagcaacgcctctgtcatgaatcttctgctcatcagc
tttgaccgttacttctcagtgacccgacccctgagctaccgagccaagcgcactccccgc
agggcagctctgatgattggcctcgcgtggttggtttccttcgttctctgggccccagcc
atcctcttctggcaatacctagttggggagcggacagtgctggctgggcagtgctacatc
cagttcctctcccaacccatcatcacttttggcacagccatggccgccttctacctccct
gtcacagtcatgtgtacgctgtactggcgcatctaccgggagacagaaaaccgagcccgg
gagctagcagccctacagggctctgagacaccaggcaaaggtggtggcagcagcagcagc
tcagagaggtcacagccaggagctgaaggctcacccgagtcacctccaggccgctgctgt
cgctgttgccgggcacccagacttctgcaggcctacagctggaaagaagaagaggaagag
gatgaaggctccatggagtccctcacatcctctgaaggtgaggagcctggctcagaagtg
gtgatcaagatgcctatggtagatcctgaggcacaggcacccaccaagcagcctcccaaa
agctccccaaatacagtcaagaggcccaccaagaaaggccgagaccgaggcggcaaaggc
caaaaaccccgagggaaggaacaactggccaagagaaagaccttctcactggtcaaggag
aagaaggcagctcggaccctgagtgccatcctgctggccttcatcctcacctggacacca
tataacatcatggtgctggtgtctacattctgcaaggactgtgttccagaaaccctatgg
gagctgggctactggctttgctacgtcaacagcactgtcaaccccatgtgctacgcactc
tgcaacaaagccttccgggacactttccgcctgctgttgctctgccgctgggacaagcgg
cgctggcgcaaaatccccaagcgccctggctctgtgcaccgcaccccctcccgccaatgc
taa

DBGET integrated database retrieval system