KEGG   Mus musculus (mouse): 12669Help
Entry
12669             CDS       T01002                                 

Gene name
Chrm1, Chrm-1, M1, M1R
Definition
cholinergic receptor, muscarinic 1, CNS
Orthology
K04129  
muscarinic acetylcholine receptor M1
Organism
mmu  Mus musculus (mouse)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
PI3K-Akt signaling pathway
Cholinergic synapse
Regulation of actin cytoskeleton
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:mmu04020]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:mmu04151]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:mmu04080]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:mmu04810]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:mmu04725]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
19 A; 19
AA seq 460 aa AA seqDB search
MNTSVPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS
SERSQPGAEGSPESPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV
VIKMPMVDPEAQAPTKQPPKSSPNTVKRPTKKGRDRGGKGQKPRGKEQLAKRKTFSLVKE
KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTVNPMCYAL
CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaacacctcagtgccccctgctgtcagtcccaacatcaccgtcttggcaccaggaaag
ggtccctggcaagtggcattcatcgggatcaccacaggcctcctgtctctggctacagtg
acaggcaacctgctggtgctcatctccttcaaggtcaacacagagctcaagacagtcaac
aactacttcctgctgagcctggcctgtgctgatctcatcattggcactttctccatgaac
ctctataccacatacctgctcatgggccactgggctctgggcacactggcctgtgacctc
tggctggccctggactatgtggccagcaacgcctctgtcatgaatcttctgctcatcagc
tttgaccgttacttctcagtgacccgacccctgagctaccgagccaagcgcactccccgc
agggcagctctgatgattggcctcgcgtggttggtttccttcgttctctgggccccagcc
atcctcttctggcaatacctagttggggagcggacagtgctggctgggcagtgctacatc
cagttcctctcccaacccatcatcacttttggcacagccatggccgccttctacctccct
gtcacagtcatgtgtacgctgtactggcgcatctaccgggagacagaaaaccgagcccgg
gagctagcagccctacagggctctgagacaccaggcaaaggtggtggcagcagcagcagc
tcagagaggtcacagccaggagctgaaggctcacccgagtcacctccaggccgctgctgt
cgctgttgccgggcacccagacttctgcaggcctacagctggaaagaagaagaggaagag
gatgaaggctccatggagtccctcacatcctctgaaggtgaggagcctggctcagaagtg
gtgatcaagatgcctatggtagatcctgaggcacaggcacccaccaagcagcctcccaaa
agctccccaaatacagtcaagaggcccaccaagaaaggccgagaccgaggcggcaaaggc
caaaaaccccgagggaaggaacaactggccaagagaaagaccttctcactggtcaaggag
aagaaggcagctcggaccctgagtgccatcctgctggccttcatcctcacctggacacca
tataacatcatggtgctggtgtctacattctgcaaggactgtgttccagaaaccctatgg
gagctgggctactggctttgctacgtcaacagcactgtcaaccccatgtgctacgcactc
tgcaacaaagccttccgggacactttccgcctgctgttgctctgccgctgggacaagcgg
cgctggcgcaaaatccccaagcgccctggctctgtgcaccgcaccccctcccgccaatgc
taa

DBGET integrated database retrieval system