KEGG   Mus musculus (mouse): 12672Help
Entry
12672             CDS       T01002                                 

Gene name
Chrm4, Chrm-4, M4
Definition
cholinergic receptor, muscarinic 4
Orthology
K04132  
muscarinic acetylcholine receptor M4
Organism
mmu  Mus musculus (mouse)
Pathway
Neuroactive ligand-receptor interaction
Cholinergic synapse
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    12672 (Chrm4)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    12672 (Chrm4)
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    12672 (Chrm4)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Acetylcholine (muscarinic) [Table]
    12672 (Chrm4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
2 E1; 2 50.63 cM
AA seq 479 aa AA seqDB search
MANFTPVNGSSANQSVRLVTTAHNHLETVEMVFIATVTGSLSLVTVVGNILVMLSIKVNR
QLQTVNNYFLFSLACADLIIGAFSMNLYTLYIIKGYWPLGAVVCDLWLALDYVVSNASVM
NLLIISFDRYFCVTKPLTYPARRTTKMAGLMIAAAWVLSFVLWAPAILFWQFVVGKRTVP
DNQCFIQFLSNPAVTFGTAIAAFYLPVVIMTVLYIHISLASRSRVHKHRPEGPKEKKAKT
LAFLKSPLMKPSIKKPPPGGASREELRNGKLEEAPPPALPPPPRPVADKDTSNESSSGSA
TQNTKERPPTELSTTEAATTPALPAPTLQPRTLNPASKWSKIQIVTKQTGSECVTAIEIV
PATPAGMRPAANVARKFASIARNQVRKKRQMAARERKVTRTIFAILLAFILTWTPYNVMV
LVNTFCQSCIPERVWSIGYWLCYVNSTINPACYALCNATFKKTFRHLLLCQYRNIGTAR
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacttcacacctgtcaatggcagctcagccaatcagtctgtgcgcctggtcaca
acagcccacaaccacctggagacagtggagatggtgttcattgcgacagtgactggttcc
ctgagcctggtgactgtggtgggtaacatcctggtgatgctgtccatcaaggtcaacagg
cagttgcagacagtcaacaactacttcctgttcagcctggcgtgtgcagatctcatcata
ggggcgttctctatgaacctttacaccttatacatcatcaagggctactggcccctgggt
gccgtggtctgtgacctgtggctggccctggactatgtggtgagcaatgcctctgtcatg
aaccttctcatcatcagctttgaccgctatttctgcgtcaccaagcccctcacctatcca
gcccgccgcactactaagatggcaggcctcatgattgcagccgcctgggtcttgtccttt
gtactctgggcccctgccatcttgttctggcagtttgtggtgggcaagaggacagtgcct
gataaccagtgcttcatccagttcttgtccaacccggcggtgaccttcggcacagccatt
gctgccttctacctgcctgtggtcatcatgacggtgctgtatattcatatctcgctggcc
agccgcagccgtgttcacaagcatcgacccgagggccccaaggagaagaaggccaagact
ctggctttcctcaagagccctctgatgaagccgagcattaagaaacctccaccagggggc
gcttctcgagaggaactgcgcaacgggaagctagaagaggctcctccgccagccctgccc
ccgcctccacgcccagtggctgacaaggacacttccaatgagtccagctcaggcagtgcc
acccagaacaccaaggaacggccacccacagagctgtccaccacagaggccgccaccaca
ccagcgctgcccgctcctaccctgcagccacgaaccctcaacccagcctccaagtggtcc
aagatccaaattgtgacaaagcagacaggcagtgaatgtgtgactgccatcgagatcgta
cctgccacgccagctggtatgcgcccagcagccaatgtggcccgaaagtttgccagcatc
gctcgtaaccaggtgcgcaagaagcggcagatggcggcccgggagcgcaaagtgactcgg
acaatctttgccattctgctggccttcatcctcacctggacaccctacaatgtcatggtc
ctggtgaacaccttttgccagagctgtatccccgaaagggtgtggtccatcggctactgg
ctctgctacgtcaacagcacgatcaaccctgcctgctatgcactctgcaatgccactttc
aaaaagaccttccggcaccttttgctgtgccagtatcggaacatcggcacagccaggtag

DBGET integrated database retrieval system