KEGG   Mus musculus (mouse): 12677Help
Entry
12677             CDS       T01002                                 

Gene name
Vsx2, Chx10, Hox-10, Hox10, or
Definition
(RefSeq) visual system homeobox 2
  KO
K09336  
visual system homeobox protein 2
Organism
mmu  Mus musculus (mouse)
Brite
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, Prd
    12677 (Vsx2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
12 D1; 12 39.28 cM
AA seq 361 aa AA seqDB search
MTGKAGEALSKPKSETVAKSTSGGAPARCTGFGIQEILGLNKEPPSSHPRAALDGLAPGH
LLAARSVLSPAGVGSMGLLGPGGLPGFYTQPTFLEVLSDPQSVHLQPLGRASGPLDTSQT
ASSDSEDVSSSDRKMSKSALNQTKKRKKRRHRTIFTSYQLEELEKAFNEAHYPDVYAREM
LAMKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMVRHSIPLPESILKSA
KDGIMDSCAPWLLGMHKKSLEAAAESGRKPEVERQALPKLDKMEQEERAPEAQAAISQEE
LRENSIAALRAKAQEHSTKVLGTVSGPDSLARNAEKPEEEDATEEDRPAEKLSPPQLEDM
A
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgacggggaaagcgggggaagcgctgagcaagcccaaatccgagacagtggccaagagt
acctcggggggcgccccggccaggtgcacagggttcggcatccaggagatcctaggcttg
aacaaggagcctcccagctcccacccgcgggctgccctcgacggcctggcccctgggcat
ttgttagctgcgcgctccgttctcagcccggcaggagtgggcagcatggggctgctgggg
cccgggggacttcccggcttctacacacagcccaccttcttggaagtgctgtccgatccg
cagagcgtccacttgcagccactaggcagagcgtcggggccgctggacaccagccagacg
gccagctccgattccgaagatgtttcctccagtgaccgaaaaatgtccaaatcggcttta
aaccagaccaagaagcgtaagaagcggcgacacaggacaatctttacttcctaccagcta
gaggagctggagaaagcattcaatgaagcccactacccagatgtctacgcccgggagatg
ctggccatgaaaacggagctcccagaagacaggatacaggtgtggttccagaaccgcaga
gccaagtggaggaagagggagaagtgctggggccggagcagcgtcatggctgagtatggt
ctctatggagccatggtgaggcactcgatccccctgccagagtctatcctcaagtctgcc
aaggatggcataatggattcctgtgccccatggctactggggatgcacaaaaagtcgctg
gaggcagcagctgagtcgggaaggaagcccgaggtggaacgccaggccctgcccaagctc
gacaagatggagcaggaggaacgggccccagaggcccaggcagccatctcccaggaagaa
ctgagggagaacagcattgccgccctccgagccaaagctcaggaacacagcaccaaggtt
ctggggactgtatctgggcctgacagcctggccagaaatgctgagaagccagaagaagag
gacgccacggaggaagacaggccagctgagaagctcagcccaccgcagctggaggacatg
gcttag

DBGET integrated database retrieval system