KEGG   Mus musculus (mouse): 12702Help
Entry
12702             CDS       T01002                                 

Gene name
Socs3, Cis3, Cish3, EF-10, Ef10, SSI-3, Ssi3
Definition
(RefSeq) suppressor of cytokine signaling 3
  KO
K04696  suppressor of cytokine signaling 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04380  Osteoclast differentiation
mmu04630  Jak-STAT signaling pathway
mmu04668  TNF signaling pathway
mmu04910  Insulin signaling pathway
mmu04917  Prolactin signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04930  Type II diabetes mellitus
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu05160  Hepatitis C
mmu05164  Influenza A
mmu05168  Herpes simplex infection
Module
mmu_M00388  ECS complex
mmu_M00684  JAK-STAT signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    12702 (Socs3)
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    12702 (Socs3)
   04668 TNF signaling pathway
    12702 (Socs3)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    12702 (Socs3)
   04920 Adipocytokine signaling pathway
    12702 (Socs3)
   04917 Prolactin signaling pathway
    12702 (Socs3)
  Development
   04380 Osteoclast differentiation
    12702 (Socs3)
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    12702 (Socs3)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    12702 (Socs3)
   04931 Insulin resistance
    12702 (Socs3)
  Infectious diseases
   05164 Influenza A
    12702 (Socs3)
   05160 Hepatitis C
    12702 (Socs3)
   05168 Herpes simplex infection
    12702 (Socs3)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     12702 (Socs3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH2 SOCS_box
Motif
Other DBs
NCBI-GeneID: 12702
NCBI-ProteinID: NP_031733
MGI: 1201791
Ensembl: ENSMUSG00000053113
Vega: OTTMUSG00000003735
UniProt: O35718
Structure
PDB: 

Jmol
Position
11; 11 E2
AA seq 225 aa AA seqDB search
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPPGTPSFSLPPTEPSSEVPEQPPAQALPGSTPKRAYYIYSGGEKIPLVLSR
PLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggtcacccacagcaagtttcccgccgccgggatgagccgccccctggacaccagcctg
cgcctcaagaccttcagctccaaaagcgagtaccagctggtggtgaacgccgtgcgcaag
ctgcaggagagcggattctactggagcgccgtgaccggcggcgaggcgaacctgctgctc
agcgccgagcccgcgggcacctttcttatccgcgacagctcggaccagcgccacttcttc
acgttgagcgtcaagacccagtcggggaccaagaacctacgcatccagtgtgaggggggc
agcttttcgctgcagagtgacccccgaagcacgcagccagttccccgcttcgactgtgta
ctcaagctggtgcaccactacatgccgcctccagggaccccctccttttctttgccaccc
acggaaccctcgtccgaagttccggagcagccacctgcccaggcactccccgggagtacc
cccaagagagcttactacatctattctgggggcgagaagattccgctggtactgagccga
cctctctcctccaacgtggccaccctccagcatctttgtcggaagactgtcaacggccac
ctggactcctatgagaaagtgacccagctgcctggacccattcgggagttcctggatcag
tatgatgctccactttaa

DBGET integrated database retrieval system