KEGG   Mus musculus (mouse): 12702Help
Entry
12702             CDS       T01002                                 

Gene name
Socs3, Cis3, Cish3, EF-10, Ef10, SSI-3, Ssi3
Definition
(RefSeq) suppressor of cytokine signaling 3
  KO
K04696  
suppressor of cytokine signaling 3
Organism
mmu  Mus musculus (mouse)
Pathway
Ubiquitin mediated proteolysis
Osteoclast differentiation
Jak-STAT signaling pathway
TNF signaling pathway
Insulin signaling pathway
Prolactin signaling pathway
Adipocytokine signaling pathway
Type II diabetes mellitus
Insulin resistance
Non-alcoholic fatty liver disease (NAFLD)
Hepatitis C
Influenza A
Herpes simplex infection
Module
ECS complex
JAK-STAT signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    12702 (Socs3)
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    12702 (Socs3)
   04668 TNF signaling pathway
    12702 (Socs3)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    12702 (Socs3)
   04920 Adipocytokine signaling pathway
    12702 (Socs3)
   04917 Prolactin signaling pathway
    12702 (Socs3)
  Development
   04380 Osteoclast differentiation
    12702 (Socs3)
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    12702 (Socs3)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    12702 (Socs3)
   04931 Insulin resistance
    12702 (Socs3)
  Infectious diseases
   05164 Influenza A
    12702 (Socs3)
   05160 Hepatitis C
    12702 (Socs3)
   05168 Herpes simplex infection
    12702 (Socs3)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     12702 (Socs3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11; 11 E2
AA seq 225 aa AA seqDB search
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPPGTPSFSLPPTEPSSEVPEQPPAQALPGSTPKRAYYIYSGGEKIPLVLSR
PLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggtcacccacagcaagtttcccgccgccgggatgagccgccccctggacaccagcctg
cgcctcaagaccttcagctccaaaagcgagtaccagctggtggtgaacgccgtgcgcaag
ctgcaggagagcggattctactggagcgccgtgaccggcggcgaggcgaacctgctgctc
agcgccgagcccgcgggcacctttcttatccgcgacagctcggaccagcgccacttcttc
acgttgagcgtcaagacccagtcggggaccaagaacctacgcatccagtgtgaggggggc
agcttttcgctgcagagtgacccccgaagcacgcagccagttccccgcttcgactgtgta
ctcaagctggtgcaccactacatgccgcctccagggaccccctccttttctttgccaccc
acggaaccctcgtccgaagttccggagcagccacctgcccaggcactccccgggagtacc
cccaagagagcttactacatctattctgggggcgagaagattccgctggtactgagccga
cctctctcctccaacgtggccaccctccagcatctttgtcggaagactgtcaacggccac
ctggactcctatgagaaagtgacccagctgcctggacccattcgggagttcctggatcag
tatgatgctccactttaa

DBGET integrated database retrieval system