KEGG   Mus musculus (mouse): 12738Help
Entry
12738             CDS       T01002                                 

Gene name
Cldn2, AL022813
Definition
(RefSeq) claudin 2
  KO
K06087  claudin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules (CAMs)
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    12738 (Cldn2)
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    12738 (Cldn2)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    12738 (Cldn2)
 Human Diseases
  Infectious diseases
   05160 Hepatitis C
    12738 (Cldn2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   12738 (Cldn2)
  Exosomal proteins of colorectal cancer cells
   12738 (Cldn2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 Amastin UPF0640
Motif
Other DBs
NCBI-GeneID: 12738
NCBI-ProteinID: NP_057884
MGI: 1276110
Ensembl: ENSMUSG00000047230
Vega: OTTMUSG00000018734
UniProt: O88552
Position
X; X F1
AA seq 230 aa AA seqDB search
MASLGVQLVGYILGLLGLLGTSIAMLLPNWRTSSYVGASIVTAVGFSKGLWMECATHSTG
ITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVVGMRCTVFCQDSRAKDRVAVV
GGVFFILGGILGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISALFSLVAGVI
LCFSCSPQGNRTNYYDGYQAQPLATRSSPRSAQQPKAKSEFNSYSLTGYV
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggcctcccttggcgtccaactggtgggctacatcctaggccttttggggctgttaggc
acatccattgccatgctgcttcccaactggcgaacgagttcctatgttggtgccagcatt
gtgacggcggttggcttttccaagggcctctggatggagtgtgcgacacacagcacaggc
atcacccagtgcgatatctacagtacccttttaggacttcctgctgacatccaggctgcc
caggccatgatggtgacgtccagtgcaatgtcctcgctggcttgtattatctctgtggtg
ggcatgagatgcaccgtgttctgccaggattctcgagctaaggacagagtggctgtagtg
ggtggagtctttttcatccttggtggcatcctgggctttatcccagttgcttggaatctt
catggcatccttcgggacttctactcgccgctggttcctgacagcatgaaatttgagatt
ggagaggctctgtacttgggcatcatctcagccctgttttctttggtagccggagtcatc
ctttgcttttcctgctcgccccagggcaatcgtaccaactactatgatggctaccaggcc
cagcctcttgccactaggagctctccaagatctgctcaacagcccaaagccaagagtgag
ttcaactcatacagcctgactgggtatgtgtga

DBGET integrated database retrieval system