KEGG   Mus musculus (mouse): 12738Help
Entry
12738             CDS       T01002                                 

Gene name
Cldn2, AL022813
Definition
(RefSeq) claudin 2
  KO
K06087  
claudin
Organism
mmu  Mus musculus (mouse)
Pathway
Cell adhesion molecules (CAMs)
Tight junction
Leukocyte transendothelial migration
Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    12738 (Cldn2)
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    12738 (Cldn2)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    12738 (Cldn2)
 Human Diseases
  Infectious diseases
   05160 Hepatitis C
    12738 (Cldn2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   12738 (Cldn2)
  Exosomal proteins of colorectal cancer cells
   12738 (Cldn2)
Cell adhesion molecules and their ligands [BR:mmu04516]
 7. Others
  CLDN; claudin [KO:K06087]
   12738 (Cldn2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
X; X F1
AA seq 230 aa AA seqDB search
MASLGVQLVGYILGLLGLLGTSIAMLLPNWRTSSYVGASIVTAVGFSKGLWMECATHSTG
ITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVVGMRCTVFCQDSRAKDRVAVV
GGVFFILGGILGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISALFSLVAGVI
LCFSCSPQGNRTNYYDGYQAQPLATRSSPRSAQQPKAKSEFNSYSLTGYV
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggcctcccttggcgtccaactggtgggctacatcctaggccttttggggctgttaggc
acatccattgccatgctgcttcccaactggcgaacgagttcctatgttggtgccagcatt
gtgacggcggttggcttttccaagggcctctggatggagtgtgcgacacacagcacaggc
atcacccagtgcgatatctacagtacccttttaggacttcctgctgacatccaggctgcc
caggccatgatggtgacgtccagtgcaatgtcctcgctggcttgtattatctctgtggtg
ggcatgagatgcaccgtgttctgccaggattctcgagctaaggacagagtggctgtagtg
ggtggagtctttttcatccttggtggcatcctgggctttatcccagttgcttggaatctt
catggcatccttcgggacttctactcgccgctggttcctgacagcatgaaatttgagatt
ggagaggctctgtacttgggcatcatctcagccctgttttctttggtagccggagtcatc
ctttgcttttcctgctcgccccagggcaatcgtaccaactactatgatggctaccaggcc
cagcctcttgccactaggagctctccaagatctgctcaacagcccaaagccaagagtgag
ttcaactcatacagcctgactgggtatgtgtga

DBGET integrated database retrieval system