KEGG   Mus musculus (mouse): 12738Help
Entry
12738             CDS       T01002                                 

Gene name
Cldn2, AL022813
Definition
(RefSeq) claudin 2
  KO
K06087  
claudin
Organism
mmu  Mus musculus (mouse)
Pathway
Cell adhesion molecules (CAMs)
Tight junction
Leukocyte transendothelial migration
Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    12738 (Cldn2)
 Cellular Processes
  Cellular commiunity
   04530 Tight junction
    12738 (Cldn2)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    12738 (Cldn2)
 Human Diseases
  Infectious diseases
   05160 Hepatitis C
    12738 (Cldn2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   12738 (Cldn2)
  Exosomal proteins of colorectal cancer cells
   12738 (Cldn2)
Cell adhesion molecules and their ligands [BR:mmu04516]
 7. Others
  CLDN; claudin [KO:K06087]
   12738 (Cldn2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
X; X F1
AA seq 230 aa AA seqDB search
MASLGVQLVGYILGLLGLLGTSIAMLLPNWRTSSYVGASIVTAVGFSKGLWMECATHSTG
ITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVVGMRCTVFCQDSRAKDRVAVV
GGVFFILGGILGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISALFSLVAGVI
LCFSCSPQGNRTNYYDGYQAQPLATRSSPRSAQQPKAKSEFNSYSLTGYV
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggcctcccttggcgtccaactggtgggctacatcctaggccttttggggctgttaggc
acatccattgccatgctgcttcccaactggcgaacgagttcctatgttggtgccagcatt
gtgacggcggttggcttttccaagggcctctggatggagtgtgcgacacacagcacaggc
atcacccagtgcgatatctacagtacccttttaggacttcctgctgacatccaggctgcc
caggccatgatggtgacgtccagtgcaatgtcctcgctggcttgtattatctctgtggtg
ggcatgagatgcaccgtgttctgccaggattctcgagctaaggacagagtggctgtagtg
ggtggagtctttttcatccttggtggcatcctgggctttatcccagttgcttggaatctt
catggcatccttcgggacttctactcgccgctggttcctgacagcatgaaatttgagatt
ggagaggctctgtacttgggcatcatctcagccctgttttctttggtagccggagtcatc
ctttgcttttcctgctcgccccagggcaatcgtaccaactactatgatggctaccaggcc
cagcctcttgccactaggagctctccaagatctgctcaacagcccaaagccaagagtgag
ttcaactcatacagcctgactgggtatgtgtga

DBGET integrated database retrieval system