KEGG   Mus musculus (mouse): 12747Help
Entry
12747             CDS       T01002                                 

Gene name
Clk1, STY
Definition
CDC-like kinase 1 (EC:2.7.12.1)
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Legionellosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Infectious diseases
   05134 Legionellosis
    12747 (Clk1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     12747 (Clk1)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   12747 (Clk1)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    12747 (Clk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1 C1.3; 1 29.09 cM
AA seq 483 aa AA seqDB search
MRHSKRTYCPDWDERDWDYGTWRSSSSHKRKKRSHSSAREQKRCRYDHSKTTDSYYLESR
SINEKAYHSRRYVDEYRNDYMGYEPGHPYGEPGSRYQMHSSKSSGRSGRSSYKSKHRSRH
HTSQHHSHGKSHRRKRSRSVEDDEEGHLICQSGDVLSARYEIVDTLGEGAFGKVVECIDH
KVGGRRVAVKIVKNVDRYCEAAQSEIQVLEHLNTTDPHSTFRCVQMLEWFEHRGHICIVF
ELLGLSTYDFIKENSFLPFRMDHIRKMAYQICKSVNFLHSNKLTHTDLKPENILFVKSDY
TEAYNPKMKRDERTIVNPDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPCD
VWSIGCILIEYYLGFTVFPTHDSREHLAMMERILGPLPKHMIQKTRKRRYFHHDRLDWDE
HSSAGRYVSRRCKPLKEFMLSQDAEHELLFDLIGKMLEYDPAKRITLKEALKHPFFYPLK
KHT
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgagacattcaaagagaacttactgtcctgactgggatgaaagagactgggattatgga
acatggagaagcagcagcagtcacaaaagaaagaagagatcacatagcagcgcccgtgag
caaaagcgctgcaggtacgatcactccaaaacgacagacagctattatctggaaagcaga
tccataaatgagaaagcttatcatagtcgacgctatgttgatgaatacaggaatgactac
atgggctacgagccagggcatccctatggagaacctggaagcagataccagatgcatagt
agcaagtcctctggtaggagtggaagaagcagttacaaaagtaaacacaggagtcgccac
cacacttcgcagcaccattcacacgggaagagtcaccgaaggaaaagatcgaggagtgta
gaggatgatgaggagggtcacctgatctgtcagagtggagacgtactaagtgcaagatat
gaaattgttgatactttaggtgaaggtgctttcggaaaagtggtggaatgcatcgatcat
aaagtgggaggtagacgtgtagcagtaaaaatagttaaaaatgtggatagatactgtgaa
gctgctcaatcggaaatacaagttttggaacacttgaatacaacagacccccatagtact
ttccgttgtgtccagatgttggagtggtttgagcatcgaggtcacatttgcattgtgttt
gaacttctggggcttagtacttatgatttcattaaggaaaacagttttctgccgtttcga
atggatcatatcaggaagatggcatatcaaatatgcaaatctgtaaactttttgcatagt
aataaattgactcatacagacttgaagcctgaaaacatcttatttgtgaagtctgactac
acagaggcttataatcccaaaatgaaacgtgatgaacgtactatagtaaatccagatatt
aaagtggtggactttggaagtgcaacatatgatgatgaacaccacagcacattggtatct
acaagacattatagagcaccggaagttattttagccctcgggtggtcacagccatgtgat
gtctggagcataggatgtattcttatcgagtattatcttggatttacagtttttccgact
catgatagcagggaacatttagcaatgatggaaaggattcttggaccactaccaaagcac
atgatacagaaaaccaggaaacgcagatatttccatcatgatcgattagattgggatgaa
cacagttctgctggcagatatgtttctcggcgctgtaaacctctgaaggagtttatgcta
tctcaggatgccgaacatgagcttctctttgacctcattgggaaaatgttggagtatgat
cccgccaaaagaattactctcaaagaagccctaaagcatcctttcttttacccacttaaa
aagcatacgtga

DBGET integrated database retrieval system