KEGG   Mus musculus (mouse): 12747Help
Entry
12747             CDS       T01002                                 

Gene name
Clk1, STY
Definition
CDC-like kinase 1 (EC:2.7.12.1)
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Legionellosis
Class
Human Diseases; Infectious diseases; Legionellosis [PATH:mmu05134]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1 C1.3; 1 29.09 cM
AA seq 483 aa AA seqDB search
MRHSKRTYCPDWDERDWDYGTWRSSSSHKRKKRSHSSAREQKRCRYDHSKTTDSYYLESR
SINEKAYHSRRYVDEYRNDYMGYEPGHPYGEPGSRYQMHSSKSSGRSGRSSYKSKHRSRH
HTSQHHSHGKSHRRKRSRSVEDDEEGHLICQSGDVLSARYEIVDTLGEGAFGKVVECIDH
KVGGRRVAVKIVKNVDRYCEAAQSEIQVLEHLNTTDPHSTFRCVQMLEWFEHRGHICIVF
ELLGLSTYDFIKENSFLPFRMDHIRKMAYQICKSVNFLHSNKLTHTDLKPENILFVKSDY
TEAYNPKMKRDERTIVNPDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPCD
VWSIGCILIEYYLGFTVFPTHDSREHLAMMERILGPLPKHMIQKTRKRRYFHHDRLDWDE
HSSAGRYVSRRCKPLKEFMLSQDAEHELLFDLIGKMLEYDPAKRITLKEALKHPFFYPLK
KHT
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgagacattcaaagagaacttactgtcctgactgggatgaaagagactgggattatgga
acatggagaagcagcagcagtcacaaaagaaagaagagatcacatagcagcgcccgtgag
caaaagcgctgcaggtacgatcactccaaaacgacagacagctattatctggaaagcaga
tccataaatgagaaagcttatcatagtcgacgctatgttgatgaatacaggaatgactac
atgggctacgagccagggcatccctatggagaacctggaagcagataccagatgcatagt
agcaagtcctctggtaggagtggaagaagcagttacaaaagtaaacacaggagtcgccac
cacacttcgcagcaccattcacacgggaagagtcaccgaaggaaaagatcgaggagtgta
gaggatgatgaggagggtcacctgatctgtcagagtggagacgtactaagtgcaagatat
gaaattgttgatactttaggtgaaggtgctttcggaaaagtggtggaatgcatcgatcat
aaagtgggaggtagacgtgtagcagtaaaaatagttaaaaatgtggatagatactgtgaa
gctgctcaatcggaaatacaagttttggaacacttgaatacaacagacccccatagtact
ttccgttgtgtccagatgttggagtggtttgagcatcgaggtcacatttgcattgtgttt
gaacttctggggcttagtacttatgatttcattaaggaaaacagttttctgccgtttcga
atggatcatatcaggaagatggcatatcaaatatgcaaatctgtaaactttttgcatagt
aataaattgactcatacagacttgaagcctgaaaacatcttatttgtgaagtctgactac
acagaggcttataatcccaaaatgaaacgtgatgaacgtactatagtaaatccagatatt
aaagtggtggactttggaagtgcaacatatgatgatgaacaccacagcacattggtatct
acaagacattatagagcaccggaagttattttagccctcgggtggtcacagccatgtgat
gtctggagcataggatgtattcttatcgagtattatcttggatttacagtttttccgact
catgatagcagggaacatttagcaatgatggaaaggattcttggaccactaccaaagcac
atgatacagaaaaccaggaaacgcagatatttccatcatgatcgattagattgggatgaa
cacagttctgctggcagatatgtttctcggcgctgtaaacctctgaaggagtttatgcta
tctcaggatgccgaacatgagcttctctttgacctcattgggaaaatgttggagtatgat
cccgccaaaagaattactctcaaagaagccctaaagcatcctttcttttacccacttaaa
aagcatacgtga

DBGET integrated database retrieval system