KEGG   Mus musculus (mouse): 12748Help
Entry
12748             CDS       T01002                                 

Gene name
Clk2, AU041688, Tu52
Definition
CDC-like kinase 2 (EC:2.7.12.1)
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     12748 (Clk2)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   12748 (Clk2)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    12748 (Clk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
3 F1; 3
AA seq 498 aa AA seqDB search
MPHPRRYHSSERGSRGSYHEHYQSRKHKRRRSRSWSSSSDRTRRRRREDSYHVRSRSYDD
HSSDRRLYDRRYCGSYRRNDYSRDRGEAYYDTDFRQSYEYHRENSSYRSQRSSRRKHRRR
RRRSRTFSRSSSHSSRRAKSVEDDAEGHLIYHVGDWLQERYEIVSTLGEGTFGRVVQCVD
HRRGGTQVALKIIKNVEKYKEAARLEINVLEKINEKDPDNKNLCVQMFDWFDYHGHMCIS
FELLGLSTFDFLKDNNYLPYPIHQVRHMAFQLCQAVKFLHDNKLTHTDLKPENILFVNSD
YELTYNLEKKRDERSVKSTAVRVVDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQPC
DVWSIGCIIFEYYVGFTLFQTHDNREHLAMMERILGPVPSRMIRKTRKQKYFYRGRLDWD
ENTSAGRYVRENCKPLRRYLTSEAEDHHQLFDLIENMLEYEPAKRLTLGEALQHPFFACL
RTEPPNTKLWDSSRDISR
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgccccatccccgaaggtaccattcctcagagcgaggtagccgggggagttaccacgaa
cactatcagagccgaaagcataagcgaagaagaagtcgctcctggtcaagtagcagtgac
cggacaaggcggcggcggagggaggacagctaccacgttcggtcccgaagctatgatgac
cattcgtccgatcggcggctgtacgatcggcggtactgtggcagctacaggcgcaatgac
tacagccgggacagaggggaggcttactacgacacagactttcggcagtcctatgaatac
catcgagagaacagcagttaccgaagccagcgcagcagccgaaggaaacacagaaggcgg
aggagacggagccggacattcagccgctcatcttcacacagcagccggagagccaagagt
gtagaggacgacgctgagggccacctcatctaccacgtcggggactggctacaagagcga
tatgaaattgtaagcaccttaggagaagggaccttcggccgagttgtgcagtgtgtggac
catcgcaggggcggaacacaagttgccctgaagatcattaagaatgtggagaagtacaag
gaagcagcccgactagaaatcaacgtgctggagaaaatcaatgagaaagatcctgacaac
aagaacctctgtgtccagatgtttgactggtttgactaccatggccacatgtgtatctcc
tttgagcttctgggccttagcaccttcgatttcctcaaagacaacaactacctgccctac
cccatccaccaagtgcgccacatggccttccagctctgccaggccgtcaagttcctccat
gataacaagttgacacatacggacctcaaacctgaaaatattctgtttgtgaattcagac
tacgaactcacctacaacctagagaagaagcgagatgagcgcagtgtaaagagcacagcc
gtgcgggtggtggacttcggcagtgccacctttgaccacgaacaccatagcaccattgtc
tccactcgccattaccgagcccccgaggtcatcctggagttgggctggtcacagccatgc
gatgtatggagcataggctgcatcatctttgagtactacgttggcttcaccctcttccag
acccatgacaacagagagcatctagccatgatggaaaggatcctgggtcctgtcccttct
cggatgatcagaaagacaagaaaacagaaatatttttatcggggtcgcctggattgggat
gagaacacctcagccgggcgctacgttcgtgagaactgcaaacctctgcggcggtatctg
acctcagaggcagaggaccaccaccagctcttcgatctgattgaaaatatgctagagtat
gagcctgctaagcggctgaccttaggtgaagcccttcagcatcctttcttcgcctgcctt
cggactgagccacccaacaccaagttgtgggactccagtcgggatatcagtcggtga

DBGET integrated database retrieval system