KEGG   Mus musculus (mouse): 12750Help
Entry
12750             CDS       T01002                                 

Gene name
Clk4, AI987988, C85119
Definition
CDC like kinase 4 (EC:2.7.12.1)
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
mmu  Mus musculus (mouse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 B1.3; 11
AA seq 481 aa AA seqDB search
MRHSKRTHCPDWDSRESWGHESYSGSHKRKRRSHSSTQENRHCKPHHQFKDSDCHYLEAR
CLNERDYRDRRYIDEYRNDYCEGYVPRHYHRDVESTYRIHCSKSSVRSRRSSPKRKRNRP
CASHQSHSKSHRRKRSRSIEDDEEGHLICQSGDVLRARYEIVDTLGEGAFGKVVECIDHG
MDGLHVAVKIVKNVGRYREAARSEIQVLEHLNSTDPNSVFRCVQMLEWFDHHGHVCIVFE
LLGLSTYDFIKENSFLPFQIDHIRQMAYQICQSINFLHHNKLTHTDLKPENILFVKSDYV
VKYNSKMKRDERTLKNTDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPCDV
WSIGCILIEYYLGFTVFQTHDSKEHLAMMERILGPIPAHMIQKTRKRKYFHHNQLDWDEH
SSAGRYVRRRCKPLKEFMLCHDEEHEKLFDLVRRMLEYDPARRITLDEALQHPFFDLLKR
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcggcattccaaacgaactcactgtcctgattgggatagtagagaaagctggggccat
gaaagctacagtggaagtcacaaacgcaagagaaggtctcacagcagtactcaggagaac
aggcactgtaaaccacatcatcagtttaaagactcggattgtcactatttagaagcaaga
tgcttgaatgagagagattatcgggaccggagatacattgatgaatacagaaatgactac
tgcgaaggatatgttccaagacattaccatagagacgttgaaagcacttaccggatccat
tgcagtaaatcctcagtcaggagcaggagaagcagccctaagagaaagcgtaatagaccc
tgtgcaagtcatcagtcgcattcgaagagccaccgaaggaaaagatccaggagtatagag
gatgatgaggagggtcacctgatctgtcaaagtggagacgttctaagagcaagatatgaa
atcgtggacactttaggtgaaggagcctttggcaaagttgtagagtgcattgatcacggc
atggatggcttacatgtagcagtgaaaattgtaaaaaatgtaggccgttaccgggaggca
gctcgttctgaaatccaagtattggagcacttgaacagcactgaccccaacagtgtcttc
cgatgcgtccagatgctagagtggtttgatcatcatggtcatgtttgtattgtgtttgag
ctgctgggacttagtacctatgattttattaaagaaaatagttttctgccatttcaaatt
gatcacatcaggcaaatggcttatcagatctgccagtctataaattttttacatcataat
aaattaacacacacggacctaaaacctgaaaatattttatttgtgaagtctgactatgta
gtcaaatacaattctaaaatgaaacgagatgagcgcacattgaaaaacacagatatcaaa
gttgttgattttggaagtgcaacatatgacgacgaacatcatagtactttggtgtccaca
aggcactacagggctccagaggtcattttggctctaggttggtctcagccttgtgatgtt
tggagcataggctgcattcttattgagtactaccttgggttcacagtctttcagacccac
gatagtaaagagcacctggcaatgatggagcggatcttaggacccatcccagcacatatg
atccagaagacaaggaaacgcaagtatttccaccataaccagctagattgggacgagcat
agttcagctgggagatatgttaggagacgctgcaagccgttaaaggaatttatgctgtgt
catgacgaagagcatgagaagctgtttgacctggttcgaagaatgttggagtatgaccca
gcgagaaggatcaccttggatgaagcattgcagcaccctttctttgacttattaaaaagg
aaatga

DBGET integrated database retrieval system