KEGG   Mus musculus (mouse): 12752Help
Entry
12752             CDS       T01002                                 

Gene name
Cln3, AI323623
Definition
(RefSeq) ceroid lipofuscinosis, neuronal 3, juvenile (Batten, Spielmeyer-Vogt disease)
  KO
K12389  
battenin
Organism
mmu  Mus musculus (mouse)
Pathway
Lysosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    12752 (Cln3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 F3; 7 69.16 cM
AA seq 438 aa AA seqDB search
MGSSAGSWRRLEDSEREETDSEPQAPRLDSRSVLWKNAVGFWILGLCNNFSYVVMLSAAH
DILKQEQASGNQSHVEPGPTPTPHNSSSRFDCNSISTAAVLLADILPTLVIKLLAPLGLH
LLPYSPRVLVSGVCSAGSFVLVAFSQSVGLSLCGVVLASISSGLGEVTFLSLTAFYPSAV
ISWWSSGTGGAGLLGSLSYLGLTQAGLSPQHTLLSMLGIPVLLLASYFLLLTSPEPLDPG
GENEAETAARQPLIGTETPESKPGASWDLSLQERWTVFKGLLWYIIPLVLVYFAEYFINQ
GLFELLFFRNTSLSHAQQYRWYQMLYQAGVFASRSSLQCCRIRFTWVLALLQCLNLALLL
ADVCLNFLPSIYLIFIIILYEGLLGGAAYVNTFHNIALETSDKHREFAMEAACISDTLGI
SLSGVLALPLHDFLCHLP
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgggaagttctgcgggctcgtggaggcgccttgaggattctgagagggaggagaccgac
tcagagccccaggcccctcggttggatagtcggagtgtcctttggaagaatgcagtgggt
ttctggatcttgggtctttgcaacaatttctcatatgtggtgatgctgagcgctgcccat
gacatcctcaagcaggagcaggcgtctggaaaccagagccatgtggaaccaggcccaaca
cccacaccccacaacagctcatctcgatttgactgcaactccatctccacagctgcggtg
ctcctagcagacatccttcccacccttgtcatcaaactcctggcgcctcttggccttcac
ttgctgccttacagcccccgggtgctcgtcagtggagtttgttctgctgggagctttgtt
ctggttgccttctctcagtcagtggggttaagcctgtgtggagtggttttggccagcatc
tcctcagggctaggggaggtcaccttcctctcactgactgccttctaccccagtgctgtg
atctcatggtggtcttcgggtaccgggggtgcagggcttcttggatcgctgtcttacctg
ggactcacccaggctggcctctccccgcagcacaccctactttctatgttggggatccct
gttctgctgctagccagctatttcttgttgctcacgtctcctgaacccctggaccctgga
ggggaaaacgaggcagagactgctgcccggcagcctctcataggcaccgagaccccagag
tcaaagccaggtgccagctgggacctctccctccaggaaaggtggacagtgttcaagggt
ctcttgtggtacatcatccctctggtgctggtctactttgcagaatactttatcaaccag
ggacttttcgagctcctgtttttccggaacacttccctaagccatgctcagcagtaccga
tggtaccagatgctataccaggctggtgtgttcgcctcccgctcttctctccaatgttgc
cgaatacggttcacctgggtcctagccctgctccagtgcctcaacctggccctcctgctg
gcagatgtctgcttgaacttcttgcccagcatctacctcatcttcatcatcattctgtac
gaagggctcctgggtggggccgcttacgtgaataccttccacaacattgctctggagacc
agtgacaagcaccgagagtttgccatggaagctgcctgtatctctgacaccttgggaatc
tccctgtcgggggtcctggccctgcctctgcatgacttcctctgtcacctcccttga

DBGET integrated database retrieval system