KEGG   Mus musculus (mouse): 12753Help
Entry
12753             CDS       T01002                                 

Gene name
Clock, 5330400M04Rik, KAT13D, bHLHe8, mKIAA0334
Definition
circadian locomotor output cycles kaput (EC:2.3.1.48)
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
mmu  Mus musculus (mouse)
Pathway
Circadian rhythm
Dopaminergic synapse
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    12753 (Clock)
  Environmental adaptation
   04710 Circadian rhythm
    12753 (Clock)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    12753 (Clock)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     12753 (Clock)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    12753 (Clock)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
5 C3.3; 5 40.63 cM
AA seq 855 aa AA seqDB search
MVFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSM
LPGNARKMDKSTVLQKSIDFLRKHKETTAQSDASEIRQDWKPTFLSNEEFTQLMLEALDG
FFLAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSL
TPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVRFIGNFKSLTSVSTSTHNGFEGTIQRT
HRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYL
PFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYH
QWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKSQDSGSDNRINTVSLKEA
LERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRQHLPAHEKMTQRRSSF
SSQSINSQSVGPSLTQPAMSQAANLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEAN
IHRQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSNIQQLTPVNMQGQV
VPANQVQSGHISTGQHMIQQQTLQSTSTQQSQQSVMSGHSQQTSLPSQTPSTLTAPLYNT
MVISQPAAGSMVQIPSSMPQNSTQSATVTTFTQDRQIRFSQGQQLVTKLVTAPVACGAVM
VPSTMLMGQVVTAYPTFATQQQQAQTLSVTQQQQQQQQQPPQQQQQQQQSSQEQQLPSVQ
QPAQAQLGQPPQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPPSHHQQHQPQQQQQLPR
HRTDSLTDPSKVQPQ
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atggtgtttaccgtaagctgtagtaaaatgagctcaattgttgacagagatgacagtagt
atttttgatggattggtggaagaagatgacaaggacaaagcaaaaagagtatctagaaac
aaatcagaaaagaaacgtagagatcagttcaatgtcctcattaaggagctggggtctatg
cttcctggtaacgcgagaaagatggacaagtctactgttctacagaagagcattgatttt
ttgcgcaaacataaagagaccactgcacagtcagatgctagtgagattcgacaggactgg
aaacccacattccttagtaatgaagagtttacacagttaatgttagaggctcttgatggt
ttttttttagcgatcatgacagatggaagtataatatatgtatctgagagtgtaacttcg
ttacttgaacatttaccatctgatcttgtggatcaaagtatatttaattttatcccagag
ggagaacattcagaggtttataagatactctctactcatctgctggaaagtgactcatta
acccctgagtacttaaaatcaaaaaatcagttagaattctgttgtcacatgcttcgagga
acaatagacccaaaggagccatccacctatgaatatgtgagatttataggaaattttaaa
tctttaaccagtgtatcaacttcaacacacaatggttttgaaggaactatacaacgcaca
cataggccttcttatgaagatagagtttgttttgtagctactgtcagattagctacacct
cagttcatcaaggaaatgtgtactgttgaagaaccaaatgaagagtttacatctagacac
agtttagaatggaagtttctatttttagatcacagggcaccaccaataataggctatttg
ccatttgaagtcttgggaacatcaggctatgattactatcatgtggatgacctagaaaat
ctggcaaaatgtcacgagcacttaatgcaatatggaaaaggcaaatcgtgttactataga
ttcctgaccaaaggccagcagtggatatggcttcagactcattattatattacttaccat
cagtggaattcaaggccagagttcattgtttgtactcacactgtagtaagttatgcagaa
gttagggctgaaagacggcgagaacttggcattgaagagtctcttcctgagacagctgct
gacaaaagccaagattctgggtctgacaatcgtatcaacacagtgagtctcaaggaagca
ctggaaaggtttgatcacagcccaactccttctgcctcctctagaagctcacgaaagtca
tctcacaccgcagtctcagacccttcctccacaccgacaaagatccctactgatactagc
actcctcccagacagcatttgccagctcatgaaaagatgacacagcggaggtcgtccttc
agcagtcagtccataaactcccagtcagttggtccatcattaacacagccagcgatgtct
caagctgcaaatttaccaattccacaaggcatgtcacagtttcagttttcagctcagtta
ggagccatgcagcatctaaaagaccagctagagcagcggacacggatgatagaggcaaat
attcatcggcagcaagaagaactaaggaaaattcaagagcaacttcagatggtccatggt
caagggctacagatgtttttgcagcaatcaaaccctggattgaattttggttctgttcaa
ctttcctctggaaattctaatatccagcaactcacacctgtaaatatgcaaggccaggtt
gtccctgctaaccaggttcagagtggacatatcagcacaggccagcacatgatacagcaa
cagactttacaaagtacatcaactcagcagagtcaacagagtgtaatgagtggacacagt
cagcagacgtctcttccaagtcagacaccgagcactctcacagccccactgtacaatacg
atggtgatttcccagcctgcagctgggagcatggtccagattccatccagtatgccacag
aacagtacccagagtgctacagtcactacgttcactcaggacagacagataagattttct
caaggtcagcaacttgtgaccaaattagtgactgctcctgtagcttgtggggccgtcatg
gtaccaagtaccatgcttatgggtcaggtggtgactgcctatcctaccttcgccacacaa
cagcagcaggcacagacattatcggtaacacaacagcagcagcagcagcagcagcagcca
ccacagcaacagcaacaacaacagcagagttcccaggaacagcagcttccttcagttcag
cagccagctcaggcccagctgggccagccaccacagcagttcttacagacatctaggttg
ctccacgggaatccttcgacacagctcatcctctctgctgcctttccactacaacagagc
actttccctccttcgcaccaccagcaacaccagcctcagcagcaacagcagcttcctcgg
cacaggactgacagcctgactgacccttccaaggtccagccacagtag

DBGET integrated database retrieval system