KEGG   Mus musculus (mouse): 12775Help
Entry
12775             CDS       T01002                                 

Gene name
Ccr7, CC-CKR-7, CCR-7, CD197, Cdw197, Cmkbr7, EBI1, Ebi1h
Definition
(RefSeq) chemokine (C-C motif) receptor 7
  KO
K04182  
C-C chemokine receptor type 7
Organism
mmu  Mus musculus (mouse)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12775 (Ccr7)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    12775 (Ccr7)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    12775 (Ccr7)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Chemokine
   CC Chemokine
    12775 (Ccr7)
Cytokine receptors [BR:mmu04050]
 Chemokine receptors
  CC Chemokine
   12775 (Ccr7)
Cellular antigens [BR:mmu04090]
 Proteins
  12775 (Ccr7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11; 11 D
AA seq 378 aa AA seqDB search
MDPGKPRKNVLVVALLVIFQVCFCQDEVTDDYIGENTTVDYTLYESVCFKKDVRNFKAWF
LPLMYSVICFVGLLGNGLVILTYIYFKRLKTMTDTYLLNLAVADILFLLILPFWAYSEAK
SWIFGVYLCKGIFGIYKLSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCV
GIWMLALFLSIPELLYSGLQKNSGEDTLRCSLVSAQVEALITIQVAQMVFGFLVPMLAMS
FCYLIIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYNGVVLAQTVANFNITNSSCET
SKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFRSDLFKLFKDLGCLSQERLRHWSSCRH
VRNASVSMEAETTTTFSP
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggacccagggaaacccaggaaaaacgtgctggtggtggctctccttgtcattttccag
gtgtgcttctgccaagatgaggtcaccgatgactacatcggcgagaataccacggtggac
tacaccctgtacgagtcggtgtgcttcaagaaggatgtgcggaactttaaggcctggttc
ctgcctctcatgtattctgtcatctgcttcgtgggcctgctcggcaacgggctggtgata
ctgacgtacatctatttcaagaggctcaagaccatgacggatacctacctgctcaacctg
gccgtggcagacatccttttcctcctaattcttcccttctgggcctacagcgaagccaag
tcctggatctttggcgtctacctgtgtaagggcatctttggcatctataagttaagcttc
ttcagcgggatgctgctgctcctatgcatcagcattgaccgctacgtagccatcgtccag
gccgtgtcggctcatcgccaccgcgcccgcgtgcttctcatcagcaagctgtcctgtgtg
ggcatctggatgctggccctcttcctctccatcccggagctgctctacagcggcctccag
aagaacagcggcgaggacacgctgagatgctcactggtcagtgcccaagtggaggccttg
atcaccatccaagtggcccagatggtttttgggttcctagtgcctatgctggctatgagt
ttctgctacctcattatcatccgtaccttgctccaggcacgcaactttgagcggaacaag
gccatcaaggtgatcattgccgtggtggtagtcttcatagtcttccagctgccctacaat
ggggtggtcctggctcagacggtggccaacttcaacatcaccaatagcagctgcgaaacc
agcaagcagctcaacattgcctatgacgtcacctacagcctggcctccgtccgctgctgc
gtcaaccctttcttgtatgccttcatcggcgtcaagttccgcagcgacctcttcaagctc
ttcaaggacttgggctgcctcagccaggaacggctccggcactggtcttcctgccggcat
gtacggaacgcgtcggtgagcatggaggcggagaccaccacaaccttctccccgtag

DBGET integrated database retrieval system