KEGG   Mus musculus (mouse): 12776Help
Entry
12776             CDS       T01002                                 

Gene name
Ccr8, C-C, C-C_CKR-8, CC-CKR-8, CCR-8, CKR-8, Cmkbr8, mCCR8
Definition
(RefSeq) chemokine (C-C motif) receptor 8
  KO
K04183  C-C chemokine receptor type 8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04062  Chemokine signaling pathway
mmu05167  Kaposi's sarcoma-associated herpesvirus infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12776 (Ccr8)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    12776 (Ccr8)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    12776 (Ccr8)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    12776 (Ccr8)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Chemokine
   CC Chemokine
    12776 (Ccr8)
Cytokine receptors [BR:mmu04050]
 Chemokine receptors
  CC Chemokine
   12776 (Ccr8)
CD molecules [BR:mmu04090]
 Proteins
  12776 (Ccr8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 12776
NCBI-ProteinID: NP_031746
MGI: 1201402
Ensembl: ENSMUSG00000042262
Vega: OTTMUSG00000062526
UniProt: P56484 Q3ZB17
Position
9; 9 F4
AA seq 353 aa AA seqDB search
MDYTMEPNVTMTDYYPDFFTAPCDAEFLLRGSMLYLAILYCVLFVLGLLGNSLVILVLVG
CKKLRSITDIYLLNLAASDLLFVLSIPFQTHNLLDQWVFGTAMCKVVSGLYYIGFFSSMF
FITLMSVDRYLAIVHAVYAIKVRTASVGTALSLTVWLAAVTATIPLMVFYQVASEDGMLQ
CFQFYEEQSLRWKLFTHFEINALGLLLPFAILLFCYVRILQQLRGCLNHNRTRAIKLVLT
VVIVSLLFWVPFNVALFLTSLHDLHILDGCATRQRLALAIHVTEVISFTHCCVNPVIYAF
IGEKFKKHLMDVFQKSCSHIFLYLGRQMPVGALERQLSSNQRSSHSSTLDDIL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggattacacgatggagcccaacgtcacgatgaccgactactaccctgatttcttcacc
gccccctgtgacgcagagttcctcctcaggggcagcatgctgtatctggccatcttgtac
tgcgtcttgtttgtgctgggccttctggggaacagcctggtcatcttagtcctcgtgggc
tgcaagaaactgaggagcatcacagatatctacctcctgaacctggccgcatccgacctg
ctctttgtcctctctattccttttcagacccacaacctgctggaccagtgggtgtttggg
actgcgatgtgtaaggtggtctctggcctttattacattggttttttcagcagtatgttc
ttcatcaccctaatgagtgtggacaggtatctggctattgtccacgctgtctatgccatc
aaggtgaggacggccagcgtgggcacagccctgagtctgacagtgtggctggctgctgtc
acagccaccatccccttgatggttttttaccaagtggcctctgaagacggcatgctacaa
tgtttccagttttatgaagagcagtctttgaggtggaagctctttacccactttgaaatc
aacgccttgggtctgctgctcccctttgccatcctcctgttctgctatgtcaggatcctg
cagcagctgcggggctgcctgaaccacaacaggaccagagccatcaagctggtgctcacc
gtagtcattgtgtctttactcttctgggtcccattcaacgtggcccttttcctcacgtcc
ctgcacgacctgcacatcttggatggatgtgccacgaggcagaggctggctctggccatc
catgtcacagaggtcatctcttttacccactgctgcgtgaaccccgtcatctacgcgttc
ataggagagaagtttaagaaacacctcatggatgtgtttcaaaagagctgcagccacatc
ttcctctacttagggagacaaatgcccgtgggggcgttggaaaggcagctgtcctcgaac
cagcgatcttcccattcttccaccctggatgacatcttgtaa

DBGET integrated database retrieval system