KEGG   Mus musculus (mouse): 12798Help
Entry
12798             CDS       T01002                                 

Gene name
Cnn2, AA408047, AI324678, Calpo2
Definition
(RefSeq) calponin 2
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Calponin CH CAMSAP_CH
Motif
Other DBs
NCBI-GeneID: 12798
NCBI-ProteinID: NP_031751
MGI: 105093
Ensembl: ENSMUSG00000004665
Vega: OTTMUSG00000019132
UniProt: Q08093 Q543F3
Position
10; 10 C1
AA seq 305 aa AA seqDB search
MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRSWIEGLTGLSIGPDFQKGLKDGVIL
CTLMNKLQPGSVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQV
QVSLLALAGKAKTKGLQSGVDIGVKYSEKQERNFDDATMKAGQCVIGLQMGTNKCASQSG
MTAYGTRRHLYDPKNHILPPMDHCTISLQMGTNKCASQVGMTAPGTRRHIYDTKLGTDKC
DNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGSAADGAPAGDGQGEAPEYLAYCQ
EEAGY
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgagctccacgcagttcaacaagggcccgtcctacgggctctcggccgaggtcaagaac
cggctcctgtccaaatatgacccccaaaaggaagcagaactccgaagctggatagaggga
ctcacgggcctctccattggccctgacttccagaagggtctgaaagatggggttatccta
tgcacactcatgaacaagctgcagccaggctccgtccctaaaatcaaccgctctatgcag
aactggcaccagctagaaaatctctccaacttcatcaaggccatggtcagctacggcatg
aaccctgtggacctgtttgaggccaatgacctgttcgagagcgggaacatgacacaggtg
caagtgtctctgcttgcactggctggaaaggccaagaccaaggggctgcagagtggtgtg
gacattggagttaagtattcggagaaacaggagaggaactttgacgacgccaccatgaag
gccggccagtgcgtcatcgggctgcagatgggcaccaacaagtgtgccagccagtctggc
atgacagcctatggtaccaggagacatctctatgaccccaagaaccatatcctgcctccc
atggaccactgcaccatcagcctccagatgggcaccaacaagtgtgccagccaggtgggc
atgacagctccagggacccggaggcacatctatgacaccaagctgggcaccgacaagtgc
gacaactcttccatgtccctgcagatgggctacacgcagggcgccaaccagagcggtcag
gtcttcggactggggcggcagatctacgatcccaagtattgcccacagggctctgcagct
gacggggctcctgcgggtgacggccaaggcgaggccccagagtacctggcctactgccag
gaggaagctggctactga

DBGET integrated database retrieval system