KEGG   Mus musculus (mouse): 12842Help
Entry
12842             CDS       T01002                                 

Gene name
Col1a1, Col1a-1, Cola-1, Cola1, Mov-13, Mov13
Definition
(RefSeq) collagen, type I, alpha 1
  KO
K06236  
collagen, type I, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Platelet activation
AGE-RAGE signaling pathway in diabetic complications
Protein digestion and absorption
Amoebiasis
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    12842 (Col1a1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    12842 (Col1a1)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    12842 (Col1a1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    12842 (Col1a1)
  Digestive system
   04974 Protein digestion and absorption
    12842 (Col1a1)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    12842 (Col1a1)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    12842 (Col1a1)
  Infectious diseases
   05146 Amoebiasis
    12842 (Col1a1)
Cell adhesion molecules and their ligands [BR:mmu04516]
 2. Integrin Family
  Beta1 integrins
   VLA-1
    ITGB1; integrin beta 1 [KO:K05719]
     12842 (Col1a1)
   VLA-2
     12842 (Col1a1)
   alpha 11 beta 1
     12842 (Col1a1)
 4. Link Protein Family
  CD44; CD44 antigen [KO:K06256]
   12842 (Col1a1)
 7. Others
  SDC1; syndecan 1 [KO:K06257]
   12842 (Col1a1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   12842 (Col1a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
11 59.01 cM; 11 D
AA seq 1453 aa AA seqDB search
MFSFVDLRLLLLLGATALLTHGQEDIPEVSCIHNGLRVPNGETWKPEVCLICICHNGTAV
CDDVQCNEELDCPNPQRREGECCAFCPEEYVSPNSEDVGVEGPKGDPGPQGPRGPVGPPG
RDGIPGQPGLPGPPGPPGPPGPPGLGGNFASQMSYGYDEKSAGVSVPGPMGPSGPRGLPG
PPGAPGPQGFQGPPGEPGEPGGSGPMGPRGPPGPPGKNGDDGEAGKPGRPGERGPPGPQG
ARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSPGENGAPGQMGPRGLPGERG
RPGPPGTAGARGNDGAVGAAGPPGPTGPTGPPGFPGAVGAKGEAGPQGARGSEGPQGVRG
EPGPPGPAGAAGPAGNPGADGQPGAKGANGAPGIAGAPGFPGARGPSGPQGPSGPPGPKG
NSGEPGAPGNKGDTGAKGEPGATGVQGPPGPAGEEGKRGARGEPGPSGLPGPPGERGGPG
SRGFPGADGVAGPKGPSGERGAPGPAGPKGSPGEAGRPGEAGLPGAKGLTGSPGSPGPDG
KTGPPGPAGQDGRPGPAGPPGARGQAGVMGFPGPKGTAGEPGKAGERGLPGPPGAVGPAG
KDGEAGAQGAPGPAGPAGERGEQGPAGSPGFQGLPGPAGPPGEAGKPGEQGVPGDLGAPG
PSGARGERGFPGERGVQGPPGPAGPRGNNGAPGNDGAKGDTGAPGAPGSQGAPGLQGMPG
ERGAAGLPGPKGDRGDAGPKGADGSPGKDGARGLTGPIGPPGPAGAPGDKGEAGPSGPPG
PTGARGAPGDRGEAGPPGPAGFAGPPGADGQPGAKGEPGDTGVKGDAGPPGPAGPAGPPG
PIGNVGAPGPKGPRGAAGPPGATGFPGAAGRVGPPGPSGNAGPPGPPGPVGKEGGKGPRG
ETGPAGRPGEVGPPGPPGPAGEKGSPGADGPAGSPGTPGPQGIAGQRGVVGLPGQRGERG
FPGLPGPSGEPGKQGPSGSSGERGPPGPMGPPGLAGPPGESGREGSPGAEGSPGRDGAPG
AKGDRGETGPAGPPGAPGAPGAPGPVGPAGKNGDRGETGPAGPAGPIGPAGARGPAGPQG
PRGDKGETGEQGDRGIKGHRGFSGLQGPPGSPGSPGEQGPSGASGPAGPRGPPGSAGSPG
KDGLNGLPGPIGPPGPRGRTGDSGPAGPPGPPGPPGPPGPPSGGYDFSFLPQPPQEKSQD
GGRYYRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCRDLKMCHSDWKS
GEYWIDPNQGCNLDAIKVYCNMETGQTCVFPTQPSVPQKNWYISPNPKEKKHVWFGESMT
DGFPFEYGSEGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQTGNLKKALLLQ
GSNEIELRGEGNSRFTYSTLVDGCTSHTGTWGKTVIEYKTTKTSRLPIIDVAPLDIGAPD
QEFGLDIGPACFV
NT seq 4362 nt NT seq  +upstreamnt  +downstreamnt
atgttcagctttgtggacctccggctcctgctcctcttaggggccactgccctcctgacg
catggccaagaagacatccctgaagtcagctgcatacacaatggcctaagggtccccaat
ggtgagacgtggaaacccgaggtatgcttgatctgtatctgccacaatggcacggctgtg
tgcgatgacgtgcaatgcaatgaagaactggactgtcccaacccccaaagacgggagggc
gagtgctgtgctttctgcccggaagaatacgtatcaccaaactcagaagatgtaggagtc
gagggacccaagggagaccctggcccccaaggcccaaggggacccgttggcccccctgga
cgagatggcatccctggacagcctggacttcctggtcctcctggtccccctgggcccccc
ggaccccctggccttggaggaaactttgcttcccagatgtcctatggctatgatgaaaaa
tcagctggagtttccgtgcctggccccatgggtccttctggtcctcgtggtctccctggc
ccccctggtgcacctggtccacaaggtttccaaggcccccctggtgaacctggcgagcct
ggcggttcaggtccaatgggtccccgaggtccccctggccctcctggcaagaatggagat
gatggggaagctggcaagcccggccgtcctggtgagcgtggacctcctggacctcagggt
gctcgtggattgcctggaacagctggcctccctggaatgaagggacaccgaggcttcagt
ggtttggatggtgccaaaggagatgctggtcctgctggtcctaagggagagcccggcagt
cctggtgaaaacggagctcctggccagatgggtccccgaggtctgcccggtgagagaggt
cgccctggacctcctggcactgctggtgctcgcggtaacgatggtgctgttggtgctgct
ggaccccctggtcccaccggccccactggccctcctggcttccctggtgcagttggtgct
aagggtgaagctggtccccaaggagctagaggctctgaaggtccccagggtgtgcgtggt
gagcccggaccccctggccctgctggtgctgccggccctgctggaaaccctggtgctgat
ggacaacctggcgctaaaggtgccaatggtgctcctggtattgctggtgctcctggcttc
cctggtgcccgaggcccctctggaccccagggccccagcggccctccaggtcccaagggt
aacagtggtgaacctggtgctcctggcaacaaaggagacactggtgccaaaggagaaccc
ggtgctactggagttcaaggtcccccaggccctgccggagaagaaggaaaacgaggagcc
cgtggtgagcctggaccttccggactgcctggacctcctggcgagcgtggtggacctggt
agccgtggtttccctggtgctgatggtgttgctggccccaagggtccttccggtgaacgt
ggtgctcccggacctgctggtcccaaaggttctcctggtgaagctggtcgccccggtgaa
gctggtctccctggtgccaagggtctcactggcagtcctggcagccctggtcctgatggc
aaaaccggcccccctggtcccgctggtcaagatggtcgccctggacccgcaggtcctcct
ggagcccgtggccaggctggtgtgatgggattccctggacctaagggtaccgctggagaa
cctggaaaggctggagagcgaggccttcccggaccccctggcgctgttggtcctgctggc
aaagatggagaagctggagctcagggagcccctggccctgctggtcctgctggtgagaga
ggtgaacaaggtcccgctggctcccctggattccagggtcttcctggtcctgccggtcct
cctggtgaagcaggcaagcctggtgaacagggtgttcctggagaccttggtgcccctgga
ccctctggcgcaagaggcgagagaggtttccctggtgaacgtggtgtacaaggtccccca
ggtcctgctggtccccgaggaaacaatggtgcccccggcaacgatggtgccaagggtgat
actggtgcccccggagctcccggtagccagggtgcccccggtcttcagggaatgcctggt
gaacgtggtgcagctggtcttccaggtcctaagggtgacagaggtgatgctggtcccaaa
ggtgctgatggttctcctggtaaagatggtgcccgtggtctgactggtcccattggtcct
cctggccctgctggtgcccctggtgacaagggtgaagctggtcccagtggtcctcccggt
cccaccggagcccgtggtgctcccggagaccgtggtgaggctggtccccctggtcctgct
ggctttgccggcccccctggtgctgatggccaacctggtgcgaaaggtgaacctggtgat
actggtgttaaaggtgatgctggtcctcctggccctgctggtcctgctggaccccccggc
cccattggtaacgttggtgctcctggacccaaaggtcctcgtggtgctgctggtccccct
ggtgctactggcttccctggtgctgctggccgtgtcggtccccctggtccctctggaaat
gctggaccccctggccctcccggtcccgttggcaaagaagggggcaaaggtccccgtggt
gagactggccctgctggacgtcctggtgaagttggtcccccaggtccccccggtcctgct
ggtgagaaaggatctcctggtgctgatggacctgctggctctcctggtacccctggacct
cagggtattgctggacaacgtggtgtggtcggtcttcccggtcagagaggagaaagaggc
ttccctggtcttcctggcccctctggtgaacctggcaaacaaggtccttctggatcaagt
ggtgaacgcggtccccctggccccatggggccccctggattggctggtccccctggtgaa
tctggacgtgagggatcccctggtgctgaaggctcccctggaagggatggtgctcccggg
gccaagggtgaccgtggtgagactggccccgctggcccccctggtgcccctggtgctccc
ggtgctcccggccctgttggtcccgctggcaagaatggcgatcgtggtgagactggtcct
gctggtcctgctggtcccattggccctgctggtgcccgtggccctgctggaccccaaggc
ccccgtggtgacaagggtgagacaggcgaacaaggtgacagaggcataaagggtcatcgt
ggcttctctggtctccagggtcctcctggttctcctggttctcctggtgaacaaggcccc
tctggagcttcaggtcctgcaggcccccggggtccccctggctctgctggttctcctggc
aaagacggactcaacggtctccctggccccattggtccccctggtcctcgaggtcgcact
ggtgacagcggccctgctggtccccccggccctcctggaccccctggccctcctggacct
cccagtggcggttatgacttcagcttcctgcctcagccacctcaagagaagtctcaagat
ggtggccgctactaccgggccgatgatgctaacgtggttcgtgaccgtgaccttgaggtg
gacaccaccctcaagagcctgagtcagcagattgagaacatccgcagccccgaaggcagc
cgcaagaaccctgcccgcacatgccgcgacctcaagatgtgccactctgactggaagagc
ggagagtactggatcgaccctaaccaaggctgcaacctggacgccatcaaggtctactgc
aacatggagacaggtcagacctgtgtgttccctactcagccgtctgtgcctcagaagaac
tggtacatcagcccgaaccccaaggaaaagaagcacgtctggtttggagagagcatgacc
gatggattcccgttcgagtacggaagcgagggctccgaccccgccgatgtcgctatccag
ctgaccttcctgcgcctaatgtccaccgaggcctcccagaacatcacctatcactgcaag
aacagcgtagcctacatggaccagcagactggcaacctcaagaaggccctgctcctccag
ggatccaacgagatcgagctcagaggcgaaggcaacagtcgcttcacctacagcaccctt
gtggacggctgcacgagtcacaccggaacttggggcaagacagtcatcgaatacaaaacc
accaagacctcccgcctgcccatcatcgatgtggctcccttggacattggtgccccagac
caggaattcggactagacattggccctgcctgcttcgtgtaa

DBGET integrated database retrieval system