KEGG   Mus musculus (mouse): 12845Help
Entry
12845             CDS       T01002                                 

Gene name
Comp, TSP5
Definition
cartilage oligomeric matrix protein
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
mmu  Mus musculus (mouse)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    12845 (Comp)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    12845 (Comp)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    12845 (Comp)
  Cell communication
   04510 Focal adhesion
    12845 (Comp)
 Human Diseases
  Infectious diseases
   05144 Malaria
    12845 (Comp)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   12845 (Comp)
  Exosomal proteins of colorectal cancer cells
   12845 (Comp)
  Exosomal proteins of bladder cancer cells
   12845 (Comp)
Heparan sulfate/heparin binding proteins [BR:mmu00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  12845 (Comp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
8 B3.3; 8 34.15 cM
AA seq 755 aa AA seqDB search
MGPTACVLVLALAILRATGQGQIPLGGDLAPQMLRELQETNAALQDVRELLRQQVKEITF
LKNTVMECDACGMQPARTPGLSVRPVPLCAPGSCFPGVVCSETATGARCGPCPPGYTGNG
SHCTDVNECNAHPCFPRVRCINTSPGFHCEACPPGFSGPTHEGVGLTFAKSNKQVCTDIN
ECETGQHNCVPNSVCVNTRGSFQCGPCQPGFVGDQTSGCQRRGQHFCPDGSPSPCHEKAN
CVLERDGSRSCVCAVGWAGNGLLCGRDTDLDGFPDEKLRCSERQCRKDNCVTVPNSGQED
VDRDGIGDACDPDADGDGVPNEQDNCPLVRNPDQRNSDSDKWGDACDNCRSKKNDDQKDT
DLDGRGDACDDDIDGDRIRNVADNCPRVPNFDQSDSDGDGVGDACDNCPQKDNPDQRDVD
HDFVGDACDSDQDQDGDGHQDSRDNCPTVPNSAQQDSDHDGKGDACDDDDDNDGVPDSRD
NCRLVPNPGQEDNDRDGVGDACQGDFDADKVIDKIDVCPENAEVTLTDFRAFQTVVLDPE
GDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTATDDDYAGFIFG
YQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDTAS
QVRLLWKDPRNVGWKDKTSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTAMRGGRL
GVFCFSQENIIWANLRYRCNDTIPEDYESHRLQRV
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgggccccactgcctgcgttctagtgctcgccctggctatcctgcgggcgacaggccag
ggccagatcccgctgggtggagacctggccccacagatgctgcgagaacttcaggagact
aatgcggcgctgcaagacgtgagagagctgttgcgacagcaggtcaaggagatcaccttc
ctgaagaatacggtgatggaatgtgatgcttgcggaatgcagcccgcacgcactccaggc
ctgagcgtgcggccagtgccgctctgcgcacccggctcctgcttccccggcgtagtctgc
tccgagacagctacgggcgcgcgctgcggcccctgccctcctggctacaccggcaacggc
tcgcactgcaccgacgttaatgagtgcaatgctcacccctgtttcccgcgggtgcggtgc
atcaataccagccctggctttcactgcgaagcctgtccccctgggttcagcggacccacc
cacgagggcgtgggactgaccttcgctaagtccaacaaacaagtttgcacggatattaat
gagtgtgagaccgggcagcacaattgcgttcccaactccgtgtgcgtcaacacccggggc
tccttccagtgcggcccctgccagcccggtttcgtgggcgaccagacgtcaggctgccag
cggcgtgggcagcacttctgccccgatgggtcacccagcccgtgccatgagaaagcaaac
tgcgtcctggagcgggatggctcgaggtcttgcgtgtgtgcagttggctgggccggcaac
gggctcctgtgcggccgcgacacggacctggacggttttcctgacgagaagcttcgctgc
tcagagcgccagtgtcgcaaggacaactgcgtgacggtgcccaattcggggcaggaggat
gtggaccgggacggcatcggagatgcttgtgacccggatgcggacggggatggagtccct
aacgagcaagacaattgcccgctggttcgaaacccagaccagcgtaactcggacagtgat
aagtggggagatgcctgcgacaactgccggtccaagaagaatgacgatcagaaagataca
gacctggatggccggggcgatgcctgcgacgacgacatagatggcgaccgaatacgaaat
gtagctgacaactgtccccgggtgcccaactttgaccagagtgacagtgatggtgatggt
gttggggatgcctgtgacaactgtccccagaaagataacccagaccagagggatgtggac
cacgactttgtgggtgatgcctgtgatagtgaccaagaccaggatggggatggtcaccag
gactcccgggacaactgccccacagtacccaacagtgcccagcaggactcagatcatgat
ggcaagggcgatgcctgtgatgacgatgatgacaatgacggagttcctgatagccgggac
aactgccgcttggtgcctaaccctggccaagaggacaatgaccgggatggcgtgggtgac
gcgtgtcagggtgacttcgatgctgacaaggttatagacaagatcgatgtgtgccccgag
aacgccgaggtcaccctcaccgacttcagggccttccagacggttgtgttggaccccgag
ggtgatgcgcagatcgatcccaactgggtggtgctcaatcagggaatggagatcgttcag
accatgaacagtgaccctggcctggctgtgggttacacagccttcaacggcgtggacttc
gagggcacattccatgtaaacaccgccactgatgatgactatgctggtttcatcttcggc
taccaagacagctccagtttctacgtagtcatgtggaaacagatggagcagacgtactgg
caggccaatcccttccgggctgtggctgagccagggattcagctcaaggctgtcaagtcc
tctacaggtcccggggaacagctccgaaacgcactgtggcacacgggggacacagcatcc
caggtgcggctgctgtggaaggatcctcgaaacgtgggctggaaggataaaacatcctac
cgctggttcctgcagcaccggcctcaagttggctacatcagggtgcggttctatgagggt
cctgagctagtagctgacagcaatgtggtgttggacacggccatgcgtggtggccgcctg
ggtgtcttctgcttctcccaagagaacatcatctgggctaacctgcgctaccgttgcaat
gatacaatccctgaggactacgagagtcaccggctgcagagagtctag

DBGET integrated database retrieval system