KEGG   Mus musculus (mouse): 12846Help
Entry
12846             CDS       T01002                                 

Gene name
Comt, Comt1, D16Wsu103e
Definition
catechol-O-methyltransferase (EC:2.1.1.6)
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
mmu  Mus musculus (mouse)
Pathway
Steroid hormone biosynthesis
Tyrosine metabolism
Metabolic pathways
Dopaminergic synapse
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:mmu00140]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:mmu00350]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:mmu04728]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
16 A3; 16 11.4 cM
AA seq 265 aa AA seqDB search
MLLAAVSLGLLLLAFLLLLRHLGWGLVAIGWFEFVQQPVHNLLMGGTKEQRILRHVQQHA
KPGDPQSVLEAIDTYCSEKEWAMNVGDAKGQIMDAVIREYRPSLVLELGAYCGYSAVRMA
RLLPPGARLLTMEINPDYAAITQQMLDFAGLQDKVSILIGASQDLIPQLKKKYDVDTLDM
VFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSY
LEYMKVVDGLEKAVYQGPGSSPVKS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgctgttggctgctgtctcattgggtctcctgttgctggccttcctcctgctcctgcga
cacctaggctggggcttggtggctattggttggtttgagttcgtgcagcagccggtccac
aacctgctcatgggtggcacaaaggagcagcgcatcctgcgccatgtgcagcaacacgca
aagcctggagacccccagagcgtcctggaggccattgatacctactgctcagagaaggag
tgggccatgaacgtgggtgacgcaaaaggccaaatcatggatgcagtgattcgggagtac
aggccctcgctggtgctggagctaggagcttattgtggctactcagccgtgcgaatggcc
cgcctgctgccacctggagccaggcttctcaccatggagattaaccctgactacgctgcc
atcacccagcaaatgctggacttcgcaggcctacaggacaaagtttccatcctcatcggg
gcatcccaggaccttatcccccagctgaagaagaagtacgatgtggacacattagacatg
gtctttcttgaccactggaaagaccgctaccttccagacacacttctcctggaggaatgt
ggcctgctgcgcaaggggacggtgctcctagctgacaatgtcattgtcccgggaacccct
gacttcctggcgtatgtgagggggagcagcagcttcgagtgcacacactacagctcatac
ctggagtacatgaaagtggtggacggcttggagaaggcagtctaccagggtccaggcagc
agccccgtgaagtcctga

DBGET integrated database retrieval system