KEGG   Mus musculus (mouse): 12847Help
Entry
12847             CDS       T01002                                 

Gene name
Copa, AU040324, xenin
Definition
(RefSeq) coatomer protein complex subunit alpha
  KO
K05236  
coatomer subunit alpha
Organism
mmu  Mus musculus (mouse)
Brite
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    12847 (Copa)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   12847 (Copa)
  Exosomal proteins of bladder cancer cells
   12847 (Copa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1 H3; 1 79.54 cM
AA seq 1224 aa AA seqDB search
MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH
KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW
NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD
VRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAW
EVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAH
PNLNLFAAGHDGGMIVFKLERERPAYAVHGNMLHYVKDRFLRQLDFNSSKDVAVMQLRSG
SKFPVFNMSYNPAENAVLLCTRASNLENSTYDLYTIPKDADSQNPDAPEGKRSSGLTAVW
VARNRFAVLDRMHSLLIKNLKNEITKKIQVPNCDEIFYAGTGNLLLRDADSITLFDVQQK
RTLASVKISKVKYVIWSADMSHVALLAKHAIVICNRKLDALCNIHENIRVKSGAWDESGV
FIYTTSNHIKYAVTTGDHGIIRTLDLPIYVTRVKGNNVYCLDRECRPRVLTIDPTEFKFK
LALINRKYDEVLHMVRNAKLVGQSIIAYLQKKGYPEVALHFVKDEKTRFSLALECGNIEI
ALEAAKALDDKNCWEKLGEVALLQGNHQIVEMCYQRTKNFDKLSFLYLITGNLEKLRKMM
KIAEIRKDMSGHYQNALYLGDVSERVRILKNCGQKSLAYLSAATHGLDEEAESLKETFDP
EKETIPDIDPNAKLLQPPAPIMPLDTNWPLLTVSKGFFEGSIASKGKGGALAADIDIDTV
GTEGWGEDAELQLDEDGFVEAPEGLGEDVLGKGQEEGGGWDVEEDLELPPELDVPSGVSG
SAEDGFFVPPTKGTSPTQIWCNNSQLPVDHILAGSFETAMRLLHDQVGVIQFGPYKQLFL
QTYARGRTTYQALPCLPSMYSYPNRNWKDAGLKNGVPAVGLKLNDLIQRLQLCYQLTTVG
KFEEAVEKFRSILLSVPLLVVDNKQEIAEAQQLITICREYIVGLCMEIERKKLPKETLDQ
QKRICEMAAYFTHSNLQPVHMILVLRTALNLFFKLKNFKTAATFARRLLELGPKPEVAQQ
TRKILSACEKNPTDACQLNYDMHNPFDICAASYRPIYRGKPVEKCPLSGACYSPEFKGQI
CRVTTVTEIGKDVIGLRISPLQFR
NT seq 3675 nt NT seq  +upstreamnt  +downstreamnt
atgctaaccaaattcgagacgaagagcgcgcgggtcaaaggccttagttttcatcctaaa
agaccctggatcctgaccagtttacacaatggggtcatccagttatgggactatcggatg
tgcaccctaattgacaaatttgatgaacatgatggtccagtgcgtggcattgacttccat
aagcagcagccactgttcgtctctggaggcgatgattataagattaaggtttggaattac
aaacttcggcgctgcctgttcacattgctcgggcacttggattatatccgtacaacgttt
ttccatcatgaatatccttggattctgagcgcctcagatgatcagaccattcgggtgtgg
aactggcagtctagaacctgtgtctgtgtgttaacggggcacaaccattatgtaatgtgt
gctcagttccacccctctgaagacctggtggtatcagctagcctggaccagactgtccgc
gtttgggatatttctggtctaaggaagaaaaacttgtctcctggtgcggtggagtcggat
gtgagaggaataactggcgttgatctgtttggaaccacggatgccgtggtgaagcatgtg
ctagagggtcatgaccgtggagtcaactgggctgccttccacccgactatgccccttatt
gtatctggggcagatgaccggcaagtgaagatctggcgtatgaatgaatcaaaggcatgg
gaggttgacacctgccggggccattacaacaatgtgtcttgtgctgtttttcaccctcgc
caagagttgatcctcagcaattctgaagacaagagtattcgagtctgggatatgtctaag
cggactggggttcagactttccgtagggatcatgatcgcttctgggtcctggctgcccat
cccaaccttaacctctttgcagcaggccatgatggtgggatgattgtatttaagctggaa
cgtgagcgtcctgcctatgctgttcatggtaacatgctgcattatgtaaaggaccgattc
ctccgtcagctggatttcaacagctccaaagatgtagctgtgatgcagttgcggagcggt
tctaagtttccagtattcaacatgtcatacaatccagcagaaaacgcagtgctgctctgc
accagagcaagcaatctagagaacagtacctacgacctatacaccatccccaaagacgca
gactcccagaaccctgacgcccctgaagggaaacgatcctcaggcctgacagcggtttgg
gttgctcggaatcggtttgctgtcctagatcgcatgcattcacttctgattaaaaacctg
aaaaatgagatcaccaagaaaatccaggtgccaaactgtgatgaaatcttctatgctggt
acaggcaacctcctgcttcgggatgcagattccatcacactctttgacgtccagcagaag
cgaactctggcatcagtgaagatttccaaggtgaaatatgttatctggtcggcagacatg
tctcatgtagcgttactggccaagcatgccattgtgatctgtaaccgcaagctggatgct
ctgtgtaacattcatgagaacattcgtgtcaagagtggggcctgggatgaaagtggggtg
tttatctataccacaagcaaccacatcaaatatgctgtcaccactggggaccatgggatt
atccgaactctggatttacccatctatgtcaccagagtgaagggcaataatgtatactgc
ctagacagagagtgtcgtcctcgggtgctaaccattgatcccactgagttcaagttcaaa
ctggccctgatcaacagaaagtatgatgaggtactccacatggtgaggaacgctaagctg
gtaggccagtcaatcatcgcttatctccagaagaagggctatcctgaagtggcgctgcat
tttgtaaaggatgagaaaactcgtttcagcctggccctggagtgtggaaacattgagatt
gctctagaggcagccaaagccctggacgacaagaactgctgggagaagctaggagaagtg
gccctgctacagggcaatcaccaaattgtagagatgtgctatcagcgcaccaaaaacttt
gacaaactttccttcctgtaccttattactggcaacctggagaaacttcgaaagatgatg
aagatcgctgagatccgaaaggacatgagtggccattatcagaatgccctatacctaggt
gatgtgtcagagagagtacggatcctgaagaactgtgggcagaaatccctagcctatctc
tcagctgctacccatggcttagatgaagaagctgagagcctgaaggaaacctttgaccct
gagaaggagacaatcccagacattgatcctaatgccaagctgctccagccacctgcacct
atcatgccattggatacaaactggcccttactgaccgtgtccaaagggttctttgaaggc
tccattgcaagcaaggggaagggaggagcattggctgctgacattgacatcgacactgta
ggcactgaaggctggggagaggacgcagagctgcagctggatgaagatgggtttgtggag
gctccagaaggtttgggagaggatgttcttggaaagggacaagaagaaggaggtggctgg
gatgtagaagaagatttggagctcccacctgagctggatgtaccctctggggtgtctggt
agtgctgaagatgggttctttgtgcccccaaccaagggaacaagcccaacgcaaatctgg
tgcaataactcccagcttccagtagatcacatcttggcaggttcttttgaaacagccatg
cggcttctccatgatcaggtgggagtaatccagtttggcccctataagcaactgttccta
cagacatatgcccgaggccgcaccacctatcaagcgctgccctgcttgccctccatgtat
agttaccctaatcgcaattggaaggatgcagggctaaagaatggagtaccagctgtaggc
ctaaagcttaatgacctgatccaacgtttgcaactgtgttatcagctcaccacagttggc
aagtttgaggaagctgtggaaaaattccgttccatcctactcagtgtgcctcttcttgtt
gtggacaataaacaggagattgcagaggcccagcagctcatcaccatttgccgtgaatac
attgtgggtttgtgcatggagatagaaaggaagaagctacctaaggagaccctagaccag
cagaagcgcatctgtgagatggcagcctacttcacacactcaaatctgcagcctgtgcat
atgatcttggtgctgcggacagccctcaaccttttcttcaagctcaagaacttcaagaca
gctgccacctttgcccgacgcctgctggaacttgggcccaagcctgaagtagctcagcag
acaagaaaaatcttatctgcctgtgagaaaaaccccacagatgcctgccagctcaattat
gacatgcacaacccctttgacatttgtgctgcatcttaccggcccatctaccgtggaaaa
ccagtggagaagtgtccactcagtggggcctgctattcccctgagttcaaggggcaaatc
tgcagggtcactacagtgacagagattggcaaagatgtgattgggctgaggatcagtcct
cttcagtttcgctaa

DBGET integrated database retrieval system