KEGG   Mus musculus (mouse): 12858Help
Entry
12858             CDS       T01002                                 

Gene name
Cox5a, AA959768, CcOX
Definition
(RefSeq) cytochrome c oxidase subunit Va
  KO
K02264  cytochrome c oxidase subunit 5a
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu05010  Alzheimer's disease
mmu05012  Parkinson's disease
mmu05016  Huntington's disease
Module
mmu_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    12858 (Cox5a)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    12858 (Cox5a)
  Environmental adaptation
   04714 Thermogenesis
    12858 (Cox5a)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    12858 (Cox5a)
   05012 Parkinson's disease
    12858 (Cox5a)
   05016 Huntington's disease
    12858 (Cox5a)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    12858 (Cox5a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX5A
Motif
Other DBs
NCBI-GeneID: 12858
NCBI-ProteinID: NP_031773
MGI: 88474
Ensembl: ENSMUSG00000000088
Vega: OTTMUSG00000063187
UniProt: P12787
Position
9; 9 B
AA seq 146 aa AA seqDB search
MLAAALRRCTAAAAARGLLHPASAPSPAAAVCSIRCYSHGSHETDEEFDARWVTYFNKPD
IDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYP
YVIQELRPTLNELGISTPEELGLDKV
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgctcgccgctgccctccgtcgctgtaccgcagccgcggctgcccgaggcctcctgcac
cccgcctcggctcccagccccgccgccgctgtctgttccattcgctgctattctcatggg
tcacacgagacagatgaggagtttgatgctcgctgggtgacatatttcaacaagccagac
attgatgcctgggaattgcgtaaagggatgaatacacttgttggctatgatctggttcct
gagcccaaaatcattgatgctgcattgcgagcatgtagacggttaaatgattttgctagt
gctgttcgcatcttggaggttgttaaggacaaagcaggacctcataaggaaatctatccc
tatgtcatccaggaacttagaccaactttaaatgaattgggaatctccactccagaggag
ctgggccttgacaaagtgtaa

DBGET integrated database retrieval system