KEGG   Mus musculus (mouse): 12912Help
Entry
12912             CDS       T01002                                 

Gene name
Creb1, 2310001E10Rik, 3526402H21Rik, AV083133, Creb, Creb-1
Definition
cAMP responsive element binding protein 1
Orthology
K05870  
cyclic AMP-responsive element-binding protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Adrenergic signaling in cardiomyocytes
Osteoclast differentiation
Antigen processing and presentation
TNF signaling pathway
Circadian rhythm
Circadian entrainment
Cholinergic synapse
Dopaminergic synapse
Insulin secretion
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Vasopressin-regulated water reabsorption
Huntington's disease
Cocaine addiction
Amphetamine addiction
Alcoholism
Tuberculosis
Hepatitis B
HTLV-I infection
Viral carcinogenesis
Prostate cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    12912 (Creb1)
   04024 cAMP signaling pathway
    12912 (Creb1)
   04022 cGMP - PKG signaling pathway
    12912 (Creb1)
   04151 PI3K-Akt signaling pathway
    12912 (Creb1)
   04152 AMPK signaling pathway
    12912 (Creb1)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    12912 (Creb1)
  Endocrine system
   04911 Insulin secretion
    12912 (Creb1)
   04915 Estrogen signaling pathway
    12912 (Creb1)
   04918 Thyroid hormone synthesis
    12912 (Creb1)
   04916 Melanogenesis
    12912 (Creb1)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    12912 (Creb1)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    12912 (Creb1)
  Nervous system
   04725 Cholinergic synapse
    12912 (Creb1)
   04728 Dopaminergic synapse
    12912 (Creb1)
  Development
   04380 Osteoclast differentiation
    12912 (Creb1)
  Environmental adaptation
   04710 Circadian rhythm
    12912 (Creb1)
   04713 Circadian entrainment
    12912 (Creb1)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    12912 (Creb1)
   05215 Prostate cancer
    12912 (Creb1)
  Neurodegenerative diseases
   05016 Huntington's disease
    12912 (Creb1)
  Substance dependence
   05030 Cocaine addiction
    12912 (Creb1)
   05031 Amphetamine addiction
    12912 (Creb1)
   05034 Alcoholism
    12912 (Creb1)
  Infectious diseases
   05152 Tuberculosis
    12912 (Creb1)
   05166 HTLV-I infection
    12912 (Creb1)
   05161 Hepatitis B
    12912 (Creb1)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   CREB
    12912 (Creb1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    12912 (Creb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
1 C2; 1 32.74 cM
AA seq 287 aa AA seqDB search
MPAAHATSSAPTVTLVQLPNGQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQES
VDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPI
YQTSSGQYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQIL
VPSNQVVVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNR
EAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgccagcagctcatgcaacatcatctgctcccactgtaaccttagtgcagctgcccaat
gggcagacagtccaggtccatggcgttatccaggcggcccagccatcagttatccagtct
ccacaagtccaaacagttcagatttcaactattgcagaaagtgaagattcacaggagtct
gtggatagtgtaactgattcccaaaaacgaagggaaatcctttcaaggaggccttcctac
aggaaaattttgaatgacttatcttctgatgcaccaggggtgccaaggattgaagaagaa
aagtcagaagaggagacttcagcccctgccatcaccactgtaacagtgccaacccccatt
taccaaactagcagtgggcagtacattgccattacccagggaggagcaatacagctggct
aacaatggtacggatggggtacagggcctgcagacattaaccatgaccaatgcagctgcc
actcagccgggtactaccattctacagtatgcacagaccactgatggacagcagattcta
gtgcccagcaaccaagttgttgttcaagctgcctcaggcgatgtacaaacataccagatc
cgcacagcacccacgagcaccattgcccctggagttgttatggcgtcctccccagcactt
cctacacagcctgctgaagaagcagcacggaagagagaggtccgtctaatgaagaacagg
gaggcagcaagagaatgtcgtagaaagaagaaagaatatgtgaaatgtttagagaacaga
gtggcagtgcttgaaaaccaaaacaaaacattgattgaggagctaaaagcacttaaggac
ctttactgccacaaatcagattaa

DBGET integrated database retrieval system