KEGG   Mus musculus (mouse): 12914Help
Entry
12914             CDS       T01002                                 

Gene name
Crebbp, AW558298, CBP, CBP/p300, KAT3A, p300/CBP
Definition
(RefSeq) CREB binding protein
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04110  Cell cycle
mmu04310  Wnt signaling pathway
mmu04330  Notch signaling pathway
mmu04350  TGF-beta signaling pathway
mmu04520  Adherens junction
mmu04630  Jak-STAT signaling pathway
mmu04720  Long-term potentiation
mmu04916  Melanogenesis
mmu04919  Thyroid hormone signaling pathway
mmu04922  Glucagon signaling pathway
mmu05016  Huntington's disease
mmu05152  Tuberculosis
mmu05161  Hepatitis B
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05166  HTLV-I infection
mmu05167  Kaposi's sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05206  MicroRNAs in cancer
mmu05211  Renal cell carcinoma
mmu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    12914 (Crebbp)
   04330 Notch signaling pathway
    12914 (Crebbp)
   04350 TGF-beta signaling pathway
    12914 (Crebbp)
   04630 Jak-STAT signaling pathway
    12914 (Crebbp)
   04066 HIF-1 signaling pathway
    12914 (Crebbp)
   04068 FoxO signaling pathway
    12914 (Crebbp)
   04024 cAMP signaling pathway
    12914 (Crebbp)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    12914 (Crebbp)
  Cellular community - eukaryotes
   04520 Adherens junction
    12914 (Crebbp)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    12914 (Crebbp)
   04919 Thyroid hormone signaling pathway
    12914 (Crebbp)
   04916 Melanogenesis
    12914 (Crebbp)
  Nervous system
   04720 Long-term potentiation
    12914 (Crebbp)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    12914 (Crebbp)
   05206 MicroRNAs in cancer
    12914 (Crebbp)
   05203 Viral carcinogenesis
    12914 (Crebbp)
   05211 Renal cell carcinoma
    12914 (Crebbp)
   05215 Prostate cancer
    12914 (Crebbp)
  Neurodegenerative diseases
   05016 Huntington's disease
    12914 (Crebbp)
  Infectious diseases
   05152 Tuberculosis
    12914 (Crebbp)
   05166 HTLV-I infection
    12914 (Crebbp)
   05164 Influenza A
    12914 (Crebbp)
   05161 Hepatitis B
    12914 (Crebbp)
   05168 Herpes simplex infection
    12914 (Crebbp)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    12914 (Crebbp)
   05169 Epstein-Barr virus infection
    12914 (Crebbp)
   05165 Human papillomavirus infection
    12914 (Crebbp)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     12914 (Crebbp)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    12914 (Crebbp)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    12914 (Crebbp)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    12914 (Crebbp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Motif
Other DBs
NCBI-GeneID: 12914
NCBI-ProteinID: NP_001020603
MGI: 1098280
Ensembl: ENSMUSG00000022521
Vega: OTTMUSG00000048175
UniProt: Q6GQV9 F8VPR5
Structure
PDB: 

Jmol
Position
16 A1; 16 2.4 cM
AA seq 2441 aa AA seqDB search
MAENLLDGPPNPKRAKLSSPGFSANDNTDFGSLFDLENDLPDELIPNGELSLLNSGNLVP
DAASKHKQLSELLRGGSGSSINPGIGNVSASSPVQQGLGGQAQGQPNSTNMASLGAMGKS
PLNQGDSSTPNLPKQAASTSGPTPPASQALNPQAQKQVGLVTSSPATSQTGPGICMNANF
NQTHPGLLNSNSGHSLMNQAQQGQAQVMNGSLGAAGRGRGAGMPYPAPAMQGATSSVLAE
TLTQVSPQMAGHAGLNTAQAGGMTKMGMTGTTSPFGQPFSQTGGQQMGATGVNPQLASKQ
SMVNSLPAFPTDIKNTSVTTVPNMSQLQTSVGIVPTQAIATGPTADPEKRKLIQQQLVLL
LHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKN
CTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGAGQQNATSLSNPNPIDPSSM
QRAYAALGLPYMNQPQTQLQPQVPGQQPAQPPAHQQMRTLNALGNNPMSIPAGGITTDQQ
PPNLISESALPTSLGATNPLMNDGSNSGNIGSLSTIPTAAPPSSTGVRKGWHEHVTQDLR
SHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKI
QKELEEKRRSRLHKQGILGNQPALPASGAQPPVIPPAQSVRPPNGPLPLPVNRMQVSQGM
NSFNPMSLGNVQLPQAPMGPRAASPMNHSVQMNSMASVPGMAISPSRMPQPPNMMGTHAN
NIMAQAPTQNQFLPQNQFPSSSGAMSVNSVGMGQPAAQAGVSQGQVPGAALPNPLNMLAP
QASQLPCPPVTQSPLHPTPPPASTAAGMPSLQHPTAPGMTPPQPAAPTQPSTPVSSGQTP
TPTPGSVPSAAQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHTQPPGT
PLSQAAASIDNRVPTPSSVTSAETSSQQPGPDVPMLEMKTEVQTDDAEPEPTESKGEPRS
EMMEEDLQGSSQVKEETDTTEQKSEPMEVEEKKPEVKVEAKEEEENSSNDTASQSTSPSQ
PRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIK
RKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYC
CGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQ
TTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPR
KENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRF
VDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHF
FRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRL
QEWYKKMLDKAFAERIINDYKDIFKQANEDRLTSAKELPYFEGDFWPNVLEESIKELEQE
EEERKKEESTAASETPEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQ
KLYATMEKHKEVFFVIHLHAGPVISTQPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFS
SLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHT
HKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMK
RVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRL
QQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVNMSPA
GFPNVARTQPPTIVSAGKPTNQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRANINN
GMPPGRAGMGTPGSQMTPVGLNVPRPNQVSGPVMSSMPPGQWQQAPIPQQQPMPGMPRPV
MSMQAQAAVAGPRMPNVQPPRSISPSALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAA
FIKQRTAKYVANQPGMQPQPGLQSQPGMQPQPGMHQQPSLQNLNAMQAGVPRPGVPPPQP
AMGGLNPQGQALNIMNPGHNPNMTNMNPQYREMVRRQLLQHQQQQQQQQQQQQQQQNSAS
LAGGMAGHSQFQQPQGPGGYAPAMQQQRMQQHLPIQGSSMGQMAAPMGQLGQMGQPGLGA
DSTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQIATSLSN
QVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSMDQGHLG
NPEQSAMLPQLNTPNRSALSSELSLVGDTTGDTLEKFVEGL
NT seq 7326 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaacttgctggacggaccgcccaaccccaaacgagccaaactcagctcgccc
ggcttctccgcgaatgacaacacagattttggatcattgtttgacttggaaaatgacctt
cctgatgagctgatccccaatggagaattaagccttttaaacagtgggaaccttgttcca
gatgctgcgtccaaacataaacaactgtcagagcttcttagaggaggcagcggctctagc
atcaacccagggataggcaatgtgagtgccagcagccctgtgcaacagggccttggtggc
caggctcaggggcagccgaacagtacaaacatggccagcttaggtgccatgggcaagagc
cctctgaaccaaggagactcatcaacacccaacctgcccaaacaggcagccagcacctct
gggcccactccccctgcctcccaagcactgaatccacaagcacaaaagcaagtagggctg
gtgaccagtagtcctgccacatcacagactggacctgggatctgcatgaatgctaacttc
aaccagacccacccaggccttctcaatagtaactctggccatagcttaatgaatcaggct
caacaagggcaagctcaagtcatgaatggatctcttggggctgctggaagaggaagggga
gctggaatgccctaccctgctccagccatgcagggggccacaagcagtgtgctggcggag
accttgacacaggtttccccacaaatggctggccatgctggactaaatacagcacaggca
ggaggcatgaccaagatgggaatgactggtaccacaagtccatttggacaaccctttagt
caaactggagggcagcagatgggagccactggagtgaacccccagttagccagcaaacag
agcatggtcaatagtttacctgcttttcctacagatatcaagaatacttcagtcaccact
gtgccaaatatgtcccagttgcaaacatcagtgggaattgtacccacacaagcaattgca
acaggccccacagcagaccctgaaaaacgcaaactgatacagcagcagctggttctactg
cttcatgcccacaaatgtcagagacgagagcaagcaaatggagaggttcgagcctgttct
ctcccacactgtcgaaccatgaaaaacgttttgaatcacatgacacattgtcaggctggg
aaagcctgccaagttgcccattgtgcatcttcacgacaaatcatctctcattggaagaac
tgcacacgacatgactgtcctgtttgcctccctttgaaaaatgccagtgacaagcgaaac
caacaaaccatcctgggatctccagctagtggaattcaaaacacaattggttctgttggt
gcagggcaacagaatgccacttccttaagtaacccaaatcccatagaccccagttccatg
cagcgggcctatgctgctctaggactcccctacatgaaccagcctcagacgcagctgcag
cctcaggttcctggccagcaaccagcacagcctccagcccaccagcagatgaggactctc
aatgccctaggaaacaaccccatgagtatcccagcaggaggaataacaacagatcaacag
ccaccaaacttgatttcagaatcagctcttccaacttccttgggggctaccaatccactg
atgaatgatggttcaaactctggtaacattggaagcctcagcacgatacctacagcagcg
cctccttccagcactggtgttcgaaaaggctggcatgaacatgtgactcaggacctacgg
agtcatctagtccataaactcgttcaagccatcttcccaactccagaccctgcagctctg
aaagatcgccgcatggagaacctggttgcctatgctaagaaagtggagggagacatgtat
gagtctgctaatagcagggatgaatactatcatttattagcagagaaaatctataaaata
caaaaagaactagaagaaaagcggaggtcacgtttacataagcaaggcatcctgggtaac
cagccagctttaccagcttctggggctcagccccctgtgattccaccagcccagtctgta
agacctccaaatgggcccctgcctttgccagtgaatcgcatgcaggtttctcaagggatg
aattcatttaacccaatgtccctgggaaacgtccagttgccacaggcacccatgggacct
cgtgcagcctcccctatgaaccactctgtgcagatgaacagcatggcctcagttccgggt
atggccatttctccttcacggatgcctcagcctccaaatatgatgggcactcatgccaac
aacattatggcccaggcacctactcagaaccagtttctgccacagaaccagtttccatca
tccagtggggcaatgagtgtgaacagtgtgggcatggggcaaccagcagcccaggcaggt
gtttcacagggtcaggtacctggagctgctctccctaaccctctgaacatgctggcaccc
caggccagccagctgccttgcccaccagtgacacagtcaccattgcacccgactccacct
cctgcttccacagctgctggcatgccctctctccaacatccaacggcaccaggaatgacc
cctcctcagccagcagctcccactcagccatctactcctgtgtcatctgggcagactcct
accccaactcctggctcagtgcccagcgctgcccaaacacagagtacccctacagtccag
gcagcagcacaggctcaggtgactccacagcctcagaccccagtgcagccaccatctgtg
gctactcctcagtcatcacagcagcaaccaacgcctgtgcatactcagcctcctggcaca
ccgctttctcaggcagcagccagcattgataatagagtccctactccctcctctgtgacc
agtgctgaaaccagttcccagcagccaggacccgatgtgcccatgctggaaatgaagaca
gaggtgcagacagatgatgctgagcctgaacctactgaatccaagggggaacctcggtct
gagatgatggaagaggatttacaaggttcttcccaagtaaaagaagagacagatacgaca
gagcagaagtcagagccaatggaagtagaagaaaagaaacctgaagtaaaagtggaagct
aaagaggaagaagagaacagttcgaacgacacagcctcacaatcaacatctccttcccag
ccacgcaaaaaaatctttaaacccgaggagctacgccaggcacttatgccaactctagaa
gcactctatcgacaggacccagagtctttgccttttcgtcagcctgtagatcctcagctc
ctaggaatcccagattattttgatatagtgaagaatcctatggacctttctaccatcaaa
cgaaagctggacacagggcaatatcaagaaccctggcagtatgtggatgatgtctggctt
atgttcaacaatgcgtggctatataatcgtaaaacgtcccgtgtatataaattttgcagt
aaacttgcagaggtctttgaacaagaaattgaccctgtcatgcagtctcttggatattgc
tgtggacgaaagtatgagttctccccacagactttgtgctgttacggaaagcagctgtgt
acaattcctcgtgatgcagcctactacagctatcagaataggtatcatttctgtgagaag
tgtttcacagagatccagggcgagaatgtgaccctgggtgacgacccttcccaacctcag
acgacaatttccaaggatcaatttgaaaagaagaaaaatgataccttagatcctgaacct
tttgttgactgcaaagagtgtggccggaagatgcatcagatttgtgttctacactatgac
atcatttggccttcaggttttgtgtgtgacaactgtttgaagaaaactggcagacctcgg
aaagaaaacaaattcagtgctaagaggctgcagaccacacgattgggaaaccacttagaa
gacagagtgaataagtttttgcggcgccagaatcaccctgaagctggggaggtttttgtc
agagtggtggccagctcagacaagactgtggaggtcaagccgggaatgaagtcaaggttt
gtggattctggagagatgtcggaatctttcccatatcgtaccaaagcactctttgctttt
gaggagatcgatggagtcgatgtgtgcttttttgggatgcatgtgcaagaatacggctct
gattgccccccaccaaatacaaggcgtgtatacatatcttatctggacagtattcatttc
ttccggccccgctgcctccggacagctgtttaccatgagatcctcatcggatatctcgag
tatgtgaagaaattggggtatgtgacaggacatatttgggcctgtcccccaagtgaagga
gatgactatatctttcattgccacccccctgaccagaaaatccccaaaccaaaacgacta
caggagtggtacaagaagatgctggacaaggcgtttgcagagaggatcattaacgactat
aaggacatcttcaaacaagcgaacgaagacaggctcacgagtgccaaggagttgccctat
tttgaaggagatttctggcctaatgtgttggaagaaagcattaaggaactagaacaagaa
gaagaagaaaggaaaaaagaagagagtactgcagcgagtgagactcctgagggcagtcag
ggtgacagcaaaaatgcgaagaaaaagaacaacaagaagaccaacaaaaacaaaagcagc
attagccgcgccaacaagaagaagcccagcatgcccaatgtttccaacgacctgtcgcag
aagctgtatgccaccatggagaagcacaaggaggtattctttgtgattcatctgcatgct
gggcctgttatcagcactcagccccccatcgtggaccctgatcctctgcttagctgtgac
ctcatggatgggcgagatgccttcctcaccctggccagagacaagcactgggaattctct
tccttacgccgctccaaatggtccactctgtgcatgctggtggagctgcacacacagggc
caggaccgctttgtttatacctgcaatgagtgcaaacaccatgtggaaacacgctggcac
tgcactgtgtgtgaggactatgacctttgtatcaattgctacaacacaaagagccacacc
cataagatggtgaagtgggggctaggcctagatgatgagggcagcagtcagggtgagcca
cagtccaagagcccccaggaatcccggcgtctcagcatccagcgctgcatccagtccctg
gtgcatgcctgccagtgtcgcaatgccaactgctcactgccgtcttgccagaagatgaag
cgagtcgtgcagcacaccaagggctgcaagcgcaagactaatggaggatgcccagtgtgc
aagcagctcattgctctttgctgctaccacgccaaacactgccaagaaaataaatgccct
gtgcccttctgcctcaacatcaaacataagctccgccagcagcagatccagcatcgcctg
cagcaggctcagctcatgcgccggcgaatggcaaccatgaacacccgcaatgtgcctcag
cagagtttgccttctcctacctcagcaccacccgggactcctacacagcagcccagcaca
ccccaaacaccacagcccccagcccagcctcagccttcacctgttaacatgtcaccagct
ggcttccctaatgtagcccggactcagcccccaacaatagtgtctgctgggaagcctacc
aaccaggtgccagctcccccaccccctgcccagcccccacctgcagcagtagaagcagcc
cggcaaattgaacgtgaggcccagcagcagcagcacctataccgagcaaacatcaacaat
ggcatgcccccaggacgtgcaggtatggggaccccaggaagccaaatgactcctgtgggc
ctgaatgtgccccgtcccaaccaagtcagtgggcctgtcatgtctagtatgccacctggg
cagtggcagcaggcacccatccctcagcagcagccgatgccaggcatgcccaggcctgta
atgtccatgcaggcccaggcagcagtggctgggccacggatgcccaatgtgcagccacca
aggagcatctcgccaagtgccctgcaagacctgctacggaccctaaagtcacccagctct
cctcagcagcagcagcaggtgctgaacatccttaaatcaaacccacagctaatggcagct
ttcatcaaacagcgcacagccaagtatgtggccaatcagcctggcatgcagccccagccc
ggacttcaatcccagcctggtatgcagccccagcctggcatgcaccagcagcctagtttg
caaaacctgaacgcaatgcaagctggtgtgccacggcctggtgtgcctccaccacaacca
gcaatgggaggcctgaatccccagggacaagctctgaacatcatgaacccaggacacaac
cccaacatgacaaacatgaatccacagtaccgagaaatggtgaggagacagctgctacag
caccagcagcagcagcagcaacagcagcagcagcagcagcaacaacaaaatagtgccagc
ttggccgggggcatggcgggacacagccagttccagcagccacaaggacctggaggttat
gccccagccatgcagcagcaacgcatgcaacagcacctccccatccagggcagctccatg
ggccagatggctgctccaatgggacaacttggccagatggggcagcctgggctaggggca
gacagcacccctaatatccagcaggccctgcagcaacggattctgcagcagcagcagatg
aagcaacaaattgggtcaccaggccagccgaaccccatgagcccccagcagcacatgctc
tcaggacagccacaggcctcacatctccctggccagcagatcgccacatcccttagtaac
caggtgcgatctccagcccctgtgcagtctccacggccccaatcccaacctccacattcc
agcccgtcaccacggatacaaccccagccttcaccacaccatgtttcaccccagactggt
tcccctcaccctggactcgcagtcaccatggccagctccatggatcagggacacctgggg
aaccctgaacagagtgcaatgctcccccagctgaatacccccaacaggagcgcactgtcc
agtgaactgtccctggttggtgataccacgggagacacactagaaaagtttgtggagggt
ttgtag

DBGET integrated database retrieval system