KEGG   Mus musculus (mouse): 12955Help
Entry
12955             CDS       T01002                                 

Gene name
Cryab, Crya-2, Crya2, HspB5, P23
Definition
(RefSeq) crystallin, alpha B
  KO
K09542  
crystallin, alpha B
Organism
mmu  Mus musculus (mouse)
Pathway
Protein processing in endoplasmic reticulum
Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    12955 (Cryab)
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    12955 (Cryab)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP20
   12955 (Cryab)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   12955 (Cryab)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
9 A5.3; 9 27.75 cM
AA seq 175 aa AA seqDB search
MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFSTATSLSPFYLRPPSFLRAPSW
IDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHR
KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVAAAPKK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggacatcgccatccaccacccctggatccggcgccccttcttccccttccactcccca
agccgcctcttcgaccagttcttcggagagcacctgttggagtctgacctcttctcaaca
gccacttccctgagccccttctaccttcggccaccctccttcctgcgggcacccagctgg
attgacaccggactctcagagatgcgtttggagaaggacagattctctgtgaatctggac
gtgaagcacttctctccggaggaactcaaagtcaaggttctgggggacgtgattgaggtc
cacggcaagcacgaagaacgccaggacgaacatggcttcatctccagggagttccacagg
aagtaccggatcccagccgatgtggatcctctcaccatcacttcatccctgtcatctgat
ggagtcctcactgtgaatggaccaaggaaacaggtgtctggccctgagcgcaccattccc
atcacccgtgaagagaagcctgctgtcgccgcagcccctaagaagtag

DBGET integrated database retrieval system