KEGG   Mus musculus (mouse): 12977Help
Entry
12977             CDS       T01002                                 

Gene name
Csf1, C87615, Csfm, MCSF, op
Definition
(RefSeq) colony stimulating factor 1 (macrophage) (EC:2.7.10.1)
  KO
K05453  
macrophage colony-stimulating factor 1
Organism
mmu  Mus musculus (mouse)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Osteoclast differentiation
Hematopoietic cell lineage
TNF signaling pathway
Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    12977 (Csf1)
   04015 Rap1 signaling pathway
    12977 (Csf1)
   04668 TNF signaling pathway
    12977 (Csf1)
   04151 PI3K-Akt signaling pathway
    12977 (Csf1)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12977 (Csf1)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    12977 (Csf1)
  Development
   04380 Osteoclast differentiation
    12977 (Csf1)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    12977 (Csf1)
Cytokines [BR:mmu04052]
 PDGF family
  4-Helix bundle growth factors
   12977 (Csf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3 46.83 cM; 3 F3
AA seq 552 aa AA seqDB search
MTARGAAGRCPSSTWLGSRLLLVCLLMSRSIAKEVSEHCSHMIGNGHLKVLQQLIDSQME
TSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLN
SCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSS
RDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELP
LRIEDPGSAKQRPPRSTCQTLESTEQPNHGDRLTEDSQPHPSAGGPVPGVEDILESSLGT
NWVLEEASGEASEGFLTQEAKFSPSTPVGGSIQAETDRPRALSASPFPKSTEDQKPVDIT
DRPLTEVNPMRPIGQTQNNTPEKTDGTSTLREDHQEPGSPHIATPNPQRVSNSATPVAQL
LLPKSHSWGIVLPLGELEGKRSTRDRRSPAELEGGSASEGAARPVARFNSIPLTDTGHVE
QHEGSSDPQIPESVFHLLVPGIILVLLTVGGLLFYKWKWRSHRDPQTLDSSVGRPEDSSL
TQDEDRQVELPV
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgcggggcgccgcggggcgctgcccttcttcgacatggctgggctcccggctg
ctgctggtctgtctcctcatgagcaggagtattgccaaggaggtgtcagaacactgtagc
cacatgattgggaatggacacctgaaggtcctgcagcagttgatcgacagtcaaatggag
acttcatgccagattgcctttgaatttgtagaccaggaacagctggatgatcctgtttgc
tacctaaagaaggccttttttctggtacaagacataatagatgagaccatgcgctttaaa
gacaacacccccaatgctaacgccaccgagaggctccaggaactctccaataacctgaac
agctgcttcaccaaggactatgaggagcagaacaaggcctgtgtccgaactttccatgag
actcctctccagctgctggagaagatcaagaacttctttaatgaaacaaagaatctcctt
gaaaaggactggaacatttttaccaagaactgcaacaacagctttgctaagtgctctagc
cgagatgtggtgaccaagcctgattgcaactgcctgtaccctaaagccacccctagcagt
gacccggcctctgcctcccctcaccagccccccgccccctccatggcccctctggctggc
ttggcttgggatgattctcagaggacagagggcagctccctcttgcccagtgagcttccc
cttcgcatagaggacccaggcagtgccaagcagcgaccacccaggagtacctgccagacc
ctcgagtcaacagagcaaccaaaccatggggacagactcactgaggactcacaacctcat
ccttctgcgggggggcccgtccctggggtggaagacattcttgaatcttcactgggcact
aactgggtcctagaagaagcttctggagaggctagtgagggatttttgacccaggaagca
aagttttccccctccacgcctgtagggggcagcatccaggcagagactgacagacccagg
gccctctcagcatctccattccctaaatcaacagaggaccaaaagccagtggatataaca
gacaggccgttgacagaggtgaaccctatgagacccattggccagacacagaataatact
cctgagaagactgatggtacatccacgctgcgtgaagaccaccaggagccaggctctccc
catattgcgacaccgaatccccaacgagtcagcaactcagccacccccgttgctcagtta
ctgcttcccaaaagccactcttggggcattgtgctgccccttggggagcttgagggcaag
agaagtaccagggatcgaaggagccccgcagagctggaaggaggatcagcaagtgagggg
gcagccaggcctgtggcccgttttaattccattcctttgactgacacaggccatgtggag
cagcatgagggatcctctgacccccagatccctgagtctgtcttccacctgctggtgccg
ggcatcatcctagtcttgctgactgttgggggcctcctgttctacaagtggaagtggagg
agccatcgagaccctcagacattggattcttctgtggggcgaccagaggacagctccctg
acccaggatgaggacagacaggtggaactgccagtatag

DBGET integrated database retrieval system